close

SimulationCraft 703-03

for World of Warcraft 7.0.3 Live (wow build level 22522)

Current simulator hotfixes

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

appendages_880 / call_880 : 314649 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
314649.0 314649.0 413.1 / 0.131% 40355.2 / 12.8% 21378.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.7 14.7 Energy 30.87% 42.8 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
appendages_880 / call_880 314649
Ashamane's Frenzy 14935 4.7% 6.1 78.61sec 1100920 1096007 Direct 91.3 10095 20190 13683 35.5%  
Periodic 30.2 133575 266987 181181 35.7% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.10 91.30 121.49 30.19 1.0045 0.6473 6719620.44 7306887.28 8.04 79267.92 1096007.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.84 64.45% 10094.53 7451 12964 10097.75 9042 11307 594010 873251 31.98
crit 32.45 35.55% 20190.18 14903 25929 20197.07 17580 22748 655242 963268 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.4 64.31% 133574.86 82156 178677 133639.72 120489 151561 2593444 2593444 0.00
crit 10.8 35.69% 266986.95 164312 357354 266924.25 206930 306585 2876924 2876924 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 36803 11.7% 18.4 23.17sec 900746 0 Periodic 144.5 84501 168948 114541 35.6% 41.4%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.37 0.00 144.49 144.49 0.0000 1.2892 16550445.43 16550445.43 0.00 88850.48 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.1 64.43% 84501.47 58 108229 84431.80 73192 91764 7866317 7866317 0.00
crit 51.4 35.57% 168947.56 116 216458 168805.36 142643 185978 8684129 8684129 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 27797 8.8% 506.3 0.89sec 24696 27858 Direct 506.3 18234 36469 24696 35.4%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 506.31 506.31 0.00 0.00 0.8865 0.0000 12503583.15 18381451.61 31.98 27857.68 27857.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 326.90 64.57% 18234.01 14216 20436 18233.83 17849 18548 5960658 8762732 31.98
crit 179.41 35.43% 36468.96 28433 40872 36469.71 35479 37318 6542925 9618719 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6363 2.0% 10.5 44.67sec 271299 270089 Direct 10.5 189317 419204 271269 35.7%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.53 10.53 0.00 0.00 1.0045 0.0000 2857814.56 4201258.10 31.98 270089.27 270089.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.78 64.34% 189316.53 14734 251221 189068.86 44644 243029 1282876 1885950 31.98
crit 3.76 35.66% 419203.53 33048 555198 414028.87 0 555198 1574938 2315308 31.61
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Horrific Slam 8151 2.6% 99.7 3.57sec 36783 0 Direct 99.7 27164 54334 36784 35.4%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.68 99.68 0.00 0.00 0.0000 0.0000 3666473.37 3666473.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.39 64.60% 27164.13 21142 30392 27168.49 24710 29299 1749109 1749109 0.00
crit 35.29 35.40% 54334.37 42285 60784 54350.44 49553 58406 1917365 1917365 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Moonfire (lunar_inspiration) 22241 7.1% 31.6 14.35sec 316960 315544 Direct 31.6 33010 66024 44715 35.5%  
Periodic 249.8 25395 50799 34399 35.4% 96.8%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.57 31.57 249.82 249.82 1.0045 1.7428 10004961.96 10004961.96 0.00 21420.09 315544.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.37 64.54% 33009.51 25727 36982 33008.89 30819 34915 672515 672515 0.00
crit 11.19 35.46% 66023.53 51454 73964 66004.32 59815 72586 738935 738935 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 161.3 64.56% 25394.97 41 28764 25394.86 24478 26020 4095486 4095486 0.00
crit 88.5 35.44% 50798.87 31 57529 50798.95 48154 52526 4498026 4498026 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2176 0.7% 24.0 18.50sec 40708 0 Periodic 71.1 13773 0 13773 0.0% 7.9%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.05 0.00 71.07 71.07 0.0000 0.4970 978872.85 1439035.80 31.98 27709.70 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.1 100.00% 13772.52 31 15493 13775.81 12825 14567 978873 1439036 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11301 3.5% 23.7 17.45sec 211841 0 Direct 23.7 156560 313217 211854 35.3%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.69 23.69 0.00 0.00 0.0000 0.0000 5017817.63 7376667.21 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.33 64.71% 156559.82 122075 175482 156533.23 141149 168329 2399752 3527863 31.98
crit 8.36 35.29% 313217.07 244149 350964 312898.08 0 350964 2618065 3848804 31.95
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 70850 22.5% 47.2 9.57sec 675826 672808 Direct 47.2 86576 172454 117261 35.7%  
Periodic 223.4 87006 173938 117885 35.5% 94.7%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.16 47.16 223.43 223.43 1.0045 1.9074 31869563.84 31869563.84 0.00 67302.10 672807.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.31 64.27% 86576.15 40286 210280 86587.80 74555 100398 2624137 2624137 0.00
crit 16.85 35.73% 172454.01 80573 420560 172365.78 125601 228261 2905304 2905304 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 144.1 64.48% 87006.09 38 210280 87036.57 78024 95655 12534444 12534444 0.00
crit 79.4 35.52% 173938.20 83 420560 174008.34 148878 208584 13805678 13805678 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 85217 27.1% 22.8 15.57sec 1682698 1675226 Periodic 326.2 86767 173532 117622 35.6% 96.0%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.80 0.00 326.15 326.15 1.0045 1.3242 38362681.58 38362681.58 0.00 84354.00 1675226.27
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 210.2 64.44% 86767.27 67 108229 86757.09 76403 91015 18236780 18236780 0.00
crit 116.0 35.56% 173531.67 323 216458 173513.09 152178 183961 20125901 20125901 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 28814 9.2% 107.7 4.17sec 120234 119695 Direct 107.7 88591 177438 120232 35.6%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.70 107.70 0.00 0.00 1.0045 0.0000 12948567.55 19035620.82 31.98 119694.65 119694.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.34 64.39% 88590.97 61977 133637 88604.46 82780 94383 6143049 9030864 31.98
crit 38.35 35.61% 177438.12 123954 267275 177374.45 161582 196322 6805519 10004757 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
appendages_880 / call_880
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:appendages_880 / call_880
  • harmful:false
  • if_expr:
 
Berserk 3.0 181.99sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Cleansed Drake's Breath 4.3 78.07sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:appendages_880 / call_880
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:appendages_880 / call_880
  • harmful:false
  • if_expr:
 
Healing Touch 50.1 9.09sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.13 0.00 0.00 0.00 0.8787 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.6 24.74sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.56 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.70sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.33sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.12% 10.19% 45.5(45.5) 15.1

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.80% 15.05% 0.0(0.0) 2.9

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.23% 0.0(0.0) 1.0

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 50.1 0.0 9.0sec 9.1sec 46.21% 46.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.99%
  • bloodtalons_2:27.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Cleansed Ancient's Blessing 4.0 0.3 86.6sec 77.9sec 9.08% 9.17% 0.3(0.3) 3.9

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_ancients_blessing_1:9.08%

Trigger Attempt Success

  • trigger_pct:98.55%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 3.9 0.3 88.2sec 79.5sec 9.00% 9.11% 0.3(0.3) 3.8

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_sisters_blessing_1:9.00%

Trigger Attempt Success

  • trigger_pct:99.04%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 3.9 0.3 87.5sec 79.0sec 9.01% 9.11% 0.3(0.3) 3.8

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_wisps_blessing_1:9.01%

Trigger Attempt Success

  • trigger_pct:98.67%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Clearcasting 43.0 1.3 10.3sec 10.0sec 6.28% 15.18% 1.3(1.3) 0.0

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.28%

Trigger Attempt Success

  • trigger_pct:8.76%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Horrific Appendages 5.6 1.0 73.2sec 60.4sec 16.82% 16.91% 100.7(100.7) 5.5

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:16.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Jacin's Ruse 6.7 1.9 63.7sec 48.0sec 24.73% 24.82% 1.9(1.9) 6.4

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.8sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 49.8 1.2 9.0sec 8.8sec 74.20% 74.21% 1.2(1.2) 0.0

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.20%

Trigger Attempt Success

  • trigger_pct:98.40%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.3 10.3 47.7sec 24.7sec 93.34% 93.04% 201.9(201.9) 7.3

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.5sec 133.5sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.82% 29.20% 0.0(0.0) 14.9

Buff details

  • buff initial source:appendages_880 / call_880
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
appendages_880 / call_880
ferocious_bite Energy 21.1 354.4 16.8 33.6 8063.6
ferocious_bite Combo Points 10.5 48.5 4.6 4.6 58881.3
lunar_inspiration Energy 31.6 783.0 24.8 24.8 12777.4
rake Energy 47.2 1340.0 28.4 28.4 23783.3
rip Energy 22.8 463.2 20.3 20.3 82823.9
rip Combo Points 22.8 114.0 5.0 5.0 336536.0
savage_roar Energy 18.6 481.7 26.0 26.0 0.0
savage_roar Combo Points 18.6 92.8 5.0 5.0 0.0
shred Energy 107.7 3195.6 29.7 29.7 4052.0
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.16 47.16 (18.24%) 1.00 0.00 0.00%
tigers_fury Energy 15.22 912.58 (11.34%) 59.97 0.40 0.04%
ashamanes_frenzy Combo Points 6.10 18.31 (7.08%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.57 31.57 (12.21%) 1.00 0.00 0.00%
shred Combo Points 107.70 107.70 (41.65%) 1.00 0.00 0.00%
energy_regen Energy 2078.41 5004.23 (62.21%) 2.41 66.24 1.31%
clearcasting Energy 42.92 1464.74 (18.21%) 34.13 0.00 0.00%
ashamanes_energy Energy 45.47 662.55 (8.24%) 14.57 19.44 2.85%
primal_fury Combo Points 66.39 53.83 (20.82%) 0.81 12.57 18.93%
Resource RPS-Gain RPS-Loss
Energy 14.62 14.71
Combo Points 0.57 0.57
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 37.18 0.20 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.26 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
clearcasting 44.3 10.0sec
clearcasting_wasted 1.3 122.2sec
primal_fury 66.4 6.8sec

Statistics & Data Analysis

Fight Length
Sample Data appendages_880 / call_880 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data appendages_880 / call_880 Damage Per Second
Count 2499
Mean 314649.05
Minimum 283468.71
Maximum 349801.38
Spread ( max - min ) 66332.67
Range [ ( max - min ) / 2 * 100% ] 10.54%
Standard Deviation 10536.0506
5th Percentile 297664.06
95th Percentile 332548.88
( 95th Percentile - 5th Percentile ) 34884.81
Mean Distribution
Standard Deviation 210.7632
95.00% Confidence Intervall ( 314235.96 - 315062.14 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4307
0.1 Scale Factor Error with Delta=300 947631
0.05 Scale Factor Error with Delta=300 3790524
0.01 Scale Factor Error with Delta=300 94763122
Priority Target DPS
Sample Data appendages_880 / call_880 Priority Target Damage Per Second
Count 2499
Mean 314649.05
Minimum 283468.71
Maximum 349801.38
Spread ( max - min ) 66332.67
Range [ ( max - min ) / 2 * 100% ] 10.54%
Standard Deviation 10536.0506
5th Percentile 297664.06
95th Percentile 332548.88
( 95th Percentile - 5th Percentile ) 34884.81
Mean Distribution
Standard Deviation 210.7632
95.00% Confidence Intervall ( 314235.96 - 315062.14 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4307
0.1 Scale Factor Error with Delta=300 947631
0.05 Scale Factor Error with Delta=300 3790524
0.01 Scale Factor Error with Delta=300 94763122
DPS(e)
Sample Data appendages_880 / call_880 Damage Per Second (Effective)
Count 2499
Mean 314649.05
Minimum 283468.71
Maximum 349801.38
Spread ( max - min ) 66332.67
Range [ ( max - min ) / 2 * 100% ] 10.54%
Damage
Sample Data appendages_880 / call_880 Damage
Count 2499
Mean 141480402.35
Minimum 106039449.12
Maximum 182797257.60
Spread ( max - min ) 76757808.48
Range [ ( max - min ) / 2 * 100% ] 27.13%
DTPS
Sample Data appendages_880 / call_880 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data appendages_880 / call_880 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data appendages_880 / call_880 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data appendages_880 / call_880 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data appendages_880 / call_880 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data appendages_880 / call_880 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data appendages_880 / call_880Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data appendages_880 / call_880 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.56 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.56 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.22 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 4.02 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 49.13 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.29 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.80 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 10.27 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 6.52 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.10 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.56 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.60 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.57 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 107.70 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQCAQIQEMJQQOPELOQQQEJQQQPEKOQCQQQEJN89PQQEJQOPEIOCQQQEJOPQEKOQPEOJQQCQQEJMOPEKOQQQEJOPQEKOCPQQEJOQQEJOPQQEIOCPQQEJOQQPEJMOQEIOPCAN89EJQQQQQEKQPQQELOQQEJOPCQQEJOQQQPEIOQQEJOPCQEJOQEMIPQQQEJOQQPEKCOQQQEJOPQEOJPQQQECIN89QQPEJQOQEOIMPCQEJOQQQPEKODPQOECABLOQQEKPQOELQQQQELOPQEKOQQQCELOPQELMQPEKOQQELOCPQELN89QQQEKPQOQ

Sample Sequence Table

time name target resources buffs
Pre flask appendages_880 / call_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food appendages_880 / call_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation appendages_880 / call_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, potion_of_the_old_war
0:01.006 lunar_inspiration Fluffy_Pillow 76.2/100: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, cleansed_wisps_blessing, potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 60.4/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, cleansed_wisps_blessing, potion_of_the_old_war
0:03.014 tigers_fury Fluffy_Pillow 34.6/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, cleansed_wisps_blessing, potion_of_the_old_war
0:03.014 berserk Fluffy_Pillow 94.6/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:03.014 shred Fluffy_Pillow 94.6/150: 63% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:04.019 savage_roar Fluffy_Pillow 103.7/150: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:05.023 shred Fluffy_Pillow 112.9/150: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:06.028 healing_touch Fluffy_Pillow 122.1/150: 81% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:06.781 ashamanes_frenzy Fluffy_Pillow 132.7/150: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:07.788 rip Fluffy_Pillow 147.0/150: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:08.792 shred Fluffy_Pillow 146.1/150: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:09.797 shred Fluffy_Pillow 140.3/150: 94% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:10.802 rake Fluffy_Pillow 134.5/150: 90% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:11.807 lunar_inspiration Fluffy_Pillow 131.2/150: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:12.812 healing_touch Fluffy_Pillow 145.4/150: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:13.566 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
0:14.569 rake Fluffy_Pillow 139.2/150: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:15.575 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.579 shred Fluffy_Pillow 144.2/150: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.583 shred Fluffy_Pillow 138.4/150: 92% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.587 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:19.339 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, potion_of_the_old_war
0:20.342 shred Fluffy_Pillow 84.2/100: 84% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
0:21.344 shred Fluffy_Pillow 58.3/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.346 Waiting 0.600 sec 32.5/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.946 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.951 Waiting 1.099 sec 15.1/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:25.050 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:26.056 healing_touch Fluffy_Pillow 14.8/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:26.810 Waiting 1.100 sec 25.5/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:27.910 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:30.446 rake Fluffy_Pillow 36.8/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar, cleansed_wisps_blessing
0:31.452 shred Fluffy_Pillow 16.0/100: 16% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing
0:32.455 Waiting 0.400 sec 30.2/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_wisps_blessing
0:32.855 tigers_fury Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_wisps_blessing
0:33.014 shred Fluffy_Pillow 98.1/100: 98% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:34.017 shred Fluffy_Pillow 87.2/100: 87% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:35.021 shred Fluffy_Pillow 76.4/100: 76% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:36.027 healing_touch Fluffy_Pillow 65.6/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:36.782 Waiting 0.700 sec 76.3/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury, cleansed_wisps_blessing
0:37.482 rip Fluffy_Pillow 86.2/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury, cleansed_wisps_blessing
0:38.487 shadowmeld Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:38.487 rake Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:38.487 auto_attack Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:39.491 lunar_inspiration Fluffy_Pillow 49.5/100: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:40.495 Waiting 0.500 sec 33.7/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:40.995 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:42.000 shred Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
0:43.005 healing_touch Fluffy_Pillow 22.6/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:43.929 Waiting 5.200 sec 32.6/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
0:49.129 rip Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
0:50.133 shred Fluffy_Pillow 70.0/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_wisps_blessing
0:51.135 rake Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_wisps_blessing
0:52.140 Waiting 1.252 sec 16.8/100: 17% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, cleansed_ancients_blessing, cleansed_wisps_blessing
0:53.392 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, cleansed_wisps_blessing
0:54.397 healing_touch Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, cleansed_wisps_blessing
0:57.116 savage_roar Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), cleansed_wisps_blessing
1:00.425 rake Fluffy_Pillow 36.8/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:01.430 Waiting 1.430 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:02.860 tigers_fury Fluffy_Pillow 28.3/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:03.014 shred Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:04.020 shred Fluffy_Pillow 75.9/100: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:05.025 shred Fluffy_Pillow 61.8/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:06.028 healing_touch Fluffy_Pillow 87.7/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:06.951 rip Fluffy_Pillow 97.7/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:07.957 rake Fluffy_Pillow 78.6/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:08.960 lunar_inspiration Fluffy_Pillow 54.5/100: 55% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:09.965 Waiting 0.500 sec 35.4/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:10.465 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:11.471 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
1:12.395 savage_roar Fluffy_Pillow 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:13.400 Waiting 0.700 sec 32.7/100: 33% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:14.100 rake Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:15.104 Waiting 2.206 sec 16.2/100: 16% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:17.310 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:18.316 Waiting 2.577 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:20.893 lunar_inspiration Fluffy_Pillow 39.1/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:21.899 Waiting 1.056 sec 20.0/100: 20% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:22.955 healing_touch Fluffy_Pillow 31.5/100: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:23.879 rake Fluffy_Pillow 41.5/100: 42% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
1:24.884 Waiting 1.293 sec 17.5/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
1:26.177 rip Fluffy_Pillow 31.5/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
1:27.180 Waiting 2.560 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
1:29.740 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
1:30.745 Waiting 1.277 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages
1:32.022 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages
1:33.026 tigers_fury Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
1:33.026 shred Fluffy_Pillow 95.9/100: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:34.030 shred Fluffy_Pillow 81.8/100: 82% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:35.034 healing_touch Fluffy_Pillow 67.7/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:35.958 rip Fluffy_Pillow 77.7/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, horrific_appendages
1:36.961 ashamanes_frenzy Fluffy_Pillow 73.6/100: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:37.967 rake Fluffy_Pillow 84.6/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:38.971 lunar_inspiration Fluffy_Pillow 95.5/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:39.976 healing_touch Fluffy_Pillow 76.4/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
1:40.901 Waiting 0.300 sec 86.4/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, horrific_appendages, jacins_ruse
1:41.201 savage_roar Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
1:42.207 rake Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
1:43.211 shred Fluffy_Pillow 36.5/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:44.215 shred Fluffy_Pillow 47.4/100: 47% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:45.221 Waiting 1.512 sec 18.3/100: 18% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:46.733 shred Fluffy_Pillow 34.8/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:47.738 healing_touch Fluffy_Pillow 45.7/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:48.662 Waiting 0.800 sec 55.7/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing, jacins_ruse
1:49.462 rip Fluffy_Pillow 64.4/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing, jacins_ruse
1:50.469 rake Fluffy_Pillow 75.3/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:51.475 lunar_inspiration Fluffy_Pillow 51.3/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:52.479 Waiting 0.800 sec 32.2/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:53.279 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:54.285 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:55.209 Waiting 4.891 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
2:00.100 savage_roar Fluffy_Pillow 75.0/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:01.103 rake Fluffy_Pillow 45.8/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:02.108 Waiting 0.698 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:02.806 tigers_fury Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:03.026 lunar_inspiration Fluffy_Pillow 91.7/100: 92% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:04.030 shred Fluffy_Pillow 87.6/100: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:05.034 shred Fluffy_Pillow 74.8/100: 75% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:06.038 healing_touch Fluffy_Pillow 62.1/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:06.863 Waiting 1.300 sec 72.1/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_sisters_blessing
2:08.163 rip Fluffy_Pillow 88.0/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
2:09.168 rake Fluffy_Pillow 70.2/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
2:10.172 shred Fluffy_Pillow 47.5/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
2:11.178 Waiting 1.731 sec 19.7/100: 20% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:12.909 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:13.912 healing_touch Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:14.819 Waiting 5.974 sec 23.1/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:20.793 rip Fluffy_Pillow 88.0/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:21.798 rake Fluffy_Pillow 68.9/100: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:22.803 lunar_inspiration Fluffy_Pillow 44.8/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:23.805 Waiting 1.400 sec 25.7/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:25.205 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:26.208 Waiting 2.615 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:28.823 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:29.827 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:30.752 Waiting 0.554 sec 21.2/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
2:31.560 savage_roar Fluffy_Pillow 29.9/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), horrific_appendages
2:32.565 rake Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages
2:33.572 tigers_fury Fluffy_Pillow 16.8/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
2:33.572 lunar_inspiration Fluffy_Pillow 76.8/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
2:34.577 shred Fluffy_Pillow 72.7/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
2:35.580 shred Fluffy_Pillow 58.6/100: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
2:36.584 healing_touch Fluffy_Pillow 44.5/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
2:37.508 Waiting 3.200 sec 54.5/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:40.708 rip Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
2:41.714 rake Fluffy_Pillow 70.2/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:42.719 shred Fluffy_Pillow 46.1/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:43.725 Waiting 2.131 sec 17.1/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:45.856 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:46.860 Waiting 1.779 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:48.639 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:49.643 healing_touch Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:50.567 Waiting 0.834 sec 21.4/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:51.401 rip Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:52.406 ashamanes_frenzy Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:54.433 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:55.438 shred Fluffy_Pillow 13.3/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:56.444 healing_touch Fluffy_Pillow 25.5/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, cleansed_sisters_blessing
2:57.779 savage_roar Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), cleansed_sisters_blessing
3:00.572 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:01.579 Waiting 1.473 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:03.052 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:04.059 tigers_fury Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar
3:04.059 berserk Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:04.059 shadowmeld Fluffy_Pillow 71.2/150: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:04.059 rake Fluffy_Pillow 71.2/150: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points shadowmeld, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:04.059 auto_attack Fluffy_Pillow 53.7/150: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:05.064 healing_touch Fluffy_Pillow 79.6/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:05.989 rip Fluffy_Pillow 89.7/150: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury
3:06.994 shred Fluffy_Pillow 100.6/150: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:07.999 shred Fluffy_Pillow 106.5/150: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:09.005 shred Fluffy_Pillow 97.4/150: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury
3:10.010 shred Fluffy_Pillow 108.3/150: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:11.015 shred Fluffy_Pillow 99.2/150: 66% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:12.019 healing_touch Fluffy_Pillow 90.1/150: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:12.945 savage_roar Fluffy_Pillow 100.2/150: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:13.947 shred Fluffy_Pillow 91.1/150: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar
3:14.951 lunar_inspiration Fluffy_Pillow 82.0/150: 55% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse
3:15.955 shred Fluffy_Pillow 77.9/150: 52% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse
3:16.960 shred Fluffy_Pillow 68.8/150: 46% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
3:17.965 healing_touch Fluffy_Pillow 59.7/150: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
3:18.889 ferocious_bite Fluffy_Pillow 69.8/150: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, horrific_appendages, jacins_ruse
3:19.893 rake Fluffy_Pillow 55.7/100: 56% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
3:20.897 Waiting 0.800 sec 31.6/100: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
3:21.697 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
3:22.701 shred Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
3:23.706 healing_touch Fluffy_Pillow 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
3:24.630 Waiting 2.300 sec 32.1/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
3:26.930 rip Fluffy_Pillow 57.1/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
3:27.935 rake Fluffy_Pillow 38.0/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
3:28.941 Waiting 1.518 sec 13.9/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:30.459 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:31.465 Waiting 2.356 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:33.821 tigers_fury Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:34.059 shred Fluffy_Pillow 99.5/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:35.063 shred Fluffy_Pillow 85.4/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:36.067 healing_touch Fluffy_Pillow 71.3/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:36.993 Waiting 0.100 sec 81.4/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
3:37.093 rip Fluffy_Pillow 97.5/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
3:38.097 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
3:39.102 shred Fluffy_Pillow 75.9/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
3:40.106 shred Fluffy_Pillow 86.8/100: 87% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
3:41.111 shred Fluffy_Pillow 57.7/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
3:42.115 Waiting 0.500 sec 28.6/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:42.615 lunar_inspiration Fluffy_Pillow 34.1/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:43.618 healing_touch Fluffy_Pillow 15.0/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:46.074 savage_roar Fluffy_Pillow 41.6/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
3:49.377 rake Fluffy_Pillow 37.5/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:50.383 Waiting 2.464 sec 13.4/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:52.847 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:53.851 Waiting 1.279 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:55.130 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
3:56.135 healing_touch Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:57.060 Waiting 1.000 sec 46.0/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:58.060 rip Fluffy_Pillow 56.8/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:59.063 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:00.067 Waiting 1.547 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:01.614 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:02.617 Waiting 1.259 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:03.876 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:04.059 shred Fluffy_Pillow 87.0/100: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:05.063 healing_touch Fluffy_Pillow 72.9/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:05.989 Waiting 0.100 sec 82.9/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:06.089 rip Fluffy_Pillow 99.0/100: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:07.093 rake Fluffy_Pillow 94.9/100: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:08.098 shred Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
4:09.102 healing_touch Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
4:10.027 ashamanes_frenzy Fluffy_Pillow 51.8/100: 52% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
4:11.032 savage_roar Fluffy_Pillow 62.7/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, tigers_fury
4:12.037 lunar_inspiration Fluffy_Pillow 73.6/100: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:13.041 shred Fluffy_Pillow 54.5/100: 55% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:14.045 shred Fluffy_Pillow 25.4/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
4:15.050 Waiting 0.400 sec 36.4/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:15.450 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:16.456 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:17.380 Waiting 1.707 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:19.087 rip Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
4:21.624 rake Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:22.629 Waiting 1.542 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:24.171 shred Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:25.177 shred Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:26.183 Waiting 1.671 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:27.854 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:28.858 healing_touch Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:29.783 Waiting 1.733 sec 21.4/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:31.516 savage_roar Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:34.055 tigers_fury Fluffy_Pillow 27.8/100: 28% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:34.059 rake Fluffy_Pillow 87.8/100: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:35.061 shred Fluffy_Pillow 78.7/100: 79% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:36.065 shred Fluffy_Pillow 64.6/100: 65% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:37.069 shred Fluffy_Pillow 50.5/100: 51% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:38.076 healing_touch Fluffy_Pillow 21.4/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:39.000 Waiting 1.000 sec 31.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:40.000 rip Fluffy_Pillow 42.3/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:42.282 rake Fluffy_Pillow 37.1/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:43.287 Waiting 1.600 sec 13.0/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:44.887 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:45.893 Waiting 2.656 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:48.549 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:49.552 Waiting 1.280 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:50.832 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:51.755 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
4:52.760 Waiting 3.395 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
4:56.155 rip Fluffy_Pillow 47.8/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
4:57.161 Waiting 0.200 sec 28.7/100: 29% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
4:57.361 lunar_inspiration Fluffy_Pillow 30.9/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
4:58.366 Waiting 1.213 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:59.579 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness
5:00.582 Waiting 0.400 sec 35.9/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
5:00.982 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness
5:01.987 shred Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
5:02.992 healing_touch Fluffy_Pillow 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
5:03.917 tigers_fury Fluffy_Pillow 32.1/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
5:04.059 savage_roar Fluffy_Pillow 93.7/100: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
5:05.062 shadowmeld Fluffy_Pillow 79.5/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:05.062 rake Fluffy_Pillow 79.5/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:05.062 auto_attack Fluffy_Pillow 44.5/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:06.065 shred Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:07.070 shred Fluffy_Pillow 56.4/100: 56% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:08.073 Waiting 0.700 sec 27.3/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:08.773 lunar_inspiration Fluffy_Pillow 34.9/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:09.777 healing_touch Fluffy_Pillow 15.8/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:10.700 Waiting 1.600 sec 25.8/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:12.300 rip Fluffy_Pillow 43.2/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:13.305 Waiting 1.500 sec 24.1/100: 24% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:14.805 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing
5:18.118 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
5:19.123 Waiting 2.572 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
5:21.695 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
5:22.699 Waiting 1.279 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
5:23.978 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
5:24.904 rake Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
5:25.907 Waiting 2.193 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:28.609 savage_roar Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, jacins_ruse
5:29.613 ashamanes_frenzy Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:30.617 Waiting 0.766 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:31.383 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:32.389 Waiting 1.456 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:33.845 tigers_fury Fluffy_Pillow 27.2/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:34.059 shred Fluffy_Pillow 89.5/100: 89% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:35.064 healing_touch Fluffy_Pillow 75.4/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:35.988 rip Fluffy_Pillow 85.4/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
5:36.991 rake Fluffy_Pillow 81.3/100: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:37.996 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:38.999 shred Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:40.003 shred Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:41.008 Waiting 1.631 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:42.639 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:43.644 healing_touch Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:44.568 Waiting 2.033 sec 21.4/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:46.601 savage_roar Fluffy_Pillow 43.5/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:49.648 rake Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:50.654 Waiting 1.252 sec 12.5/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:51.906 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:52.913 Waiting 2.294 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:55.207 lunar_inspiration Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:56.212 Waiting 2.157 sec 16.8/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:58.369 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:59.374 Waiting 1.278 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
6:01.678 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
6:02.683 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages
6:03.607 Waiting 0.268 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
6:03.875 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
6:04.059 berserk Fluffy_Pillow 87.0/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, horrific_appendages
6:04.059 potion Fluffy_Pillow 87.0/150: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, horrific_appendages
6:04.059 ferocious_bite Fluffy_Pillow 87.0/150: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
6:05.065 rake Fluffy_Pillow 100.4/150: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
6:06.070 shred Fluffy_Pillow 108.8/150: 73% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
6:07.073 shred Fluffy_Pillow 114.7/150: 76% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
6:08.079 healing_touch Fluffy_Pillow 105.7/150: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
6:09.003 savage_roar Fluffy_Pillow 115.7/150: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
6:10.006 lunar_inspiration Fluffy_Pillow 106.6/150: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
6:11.012 shred Fluffy_Pillow 102.5/150: 68% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:12.019 rake Fluffy_Pillow 93.5/150: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:13.022 healing_touch Fluffy_Pillow 86.8/150: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:13.947 ferocious_bite Fluffy_Pillow 96.9/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, horrific_appendages, cleansed_wisps_blessing, potion_of_the_old_war
6:14.951 shred Fluffy_Pillow 82.8/150: 55% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, horrific_appendages, cleansed_wisps_blessing, potion_of_the_old_war
6:15.956 shred Fluffy_Pillow 73.7/150: 49% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, horrific_appendages, cleansed_wisps_blessing, potion_of_the_old_war
6:16.962 shred Fluffy_Pillow 64.6/150: 43% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, horrific_appendages, cleansed_wisps_blessing, potion_of_the_old_war
6:17.967 shred Fluffy_Pillow 55.6/150: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, horrific_appendages, cleansed_wisps_blessing, potion_of_the_old_war
6:18.971 healing_touch Fluffy_Pillow 46.5/150: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, horrific_appendages, cleansed_wisps_blessing, potion_of_the_old_war
6:19.894 Waiting 3.100 sec 56.5/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages, cleansed_wisps_blessing, potion_of_the_old_war
6:22.994 ferocious_bite Fluffy_Pillow 90.2/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages, cleansed_wisps_blessing, potion_of_the_old_war
6:23.999 rake Fluffy_Pillow 76.1/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:25.004 lunar_inspiration Fluffy_Pillow 52.0/100: 52% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:26.008 Waiting 0.700 sec 32.9/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:26.708 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:27.713 healing_touch Fluffy_Pillow 11.4/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:28.637 Waiting 2.427 sec 21.4/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:31.064 savage_roar Fluffy_Pillow 47.8/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:33.600 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
6:34.606 shred Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
6:35.612 shred Fluffy_Pillow 57.2/100: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
6:36.617 shred Fluffy_Pillow 68.1/100: 68% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:37.623 tigers_fury Fluffy_Pillow 39.0/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:37.623 healing_touch Fluffy_Pillow 99.0/100: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:38.547 ferocious_bite Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:39.551 rake Fluffy_Pillow 75.9/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:40.556 lunar_inspiration Fluffy_Pillow 66.8/100: 67% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:41.560 shred Fluffy_Pillow 62.7/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
6:42.565 healing_touch Fluffy_Pillow 33.6/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
6:43.487 Waiting 4.200 sec 43.7/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, horrific_appendages
6:47.687 ferocious_bite Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
6:48.691 ashamanes_frenzy Fluffy_Pillow 50.2/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
6:49.696 shred Fluffy_Pillow 61.1/100: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages, cleansed_ancients_blessing
6:50.700 Waiting 0.500 sec 32.0/100: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, cleansed_ancients_blessing
6:51.200 lunar_inspiration Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, cleansed_ancients_blessing
6:52.204 healing_touch Fluffy_Pillow 18.3/100: 18% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, cleansed_ancients_blessing
6:53.130 Waiting 1.100 sec 28.4/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, cleansed_ancients_blessing
6:54.230 savage_roar Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, cleansed_ancients_blessing
6:56.516 rake Fluffy_Pillow 25.2/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:57.521 Waiting 0.400 sec 36.1/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:57.921 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:58.926 Waiting 1.257 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:00.183 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
7:01.187 healing_touch Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:02.112 Waiting 2.600 sec 45.9/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:04.712 ferocious_bite Fluffy_Pillow 74.2/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:05.717 rake Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:06.720 Waiting 1.289 sec 11.0/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:08.009 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:08.009 lunar_inspiration Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:09.014 shred Fluffy_Pillow 80.9/100: 81% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:10.020 healing_touch Fluffy_Pillow 66.8/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:10.944 Waiting 0.100 sec 76.9/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
7:11.044 ferocious_bite Fluffy_Pillow 93.0/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
7:12.047 shadowmeld Fluffy_Pillow 53.9/100: 54% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
7:12.047 rake Fluffy_Pillow 53.9/100: 54% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
7:12.047 auto_attack Fluffy_Pillow 18.9/100: 19% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
7:13.052 Waiting 1.000 sec 29.8/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
7:14.052 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
7:15.056 shred Fluffy_Pillow 11.5/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
7:16.061 Waiting 1.634 sec 22.4/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
7:17.695 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
7:18.699 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
7:19.622 Waiting 1.756 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
7:21.378 savage_roar Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing
7:22.381 lunar_inspiration Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing
7:23.386 Waiting 0.800 sec 32.0/100: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:24.186 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:27.490 rake Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
7:28.494 Waiting 1.152 sec 12.5/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:29.646 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_wisps_blessing

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 34.77% 34.77% 6568
Haste 8.61% 8.61% 2799
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 21649 19943 0
Mastery 59.64% 57.50% 7262
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 849.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Trinket2 Nature's Call
ilevel: 880, stats: { +348 Mastery, +348 Haste, +348 Crit }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="appendages_880 / call_880"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=spontaneous_appendages,id=139325,bonus_id=1806
trinket2=natures_call,id=139334,bonus_id=1806
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=848.75
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=6568
# gear_haste_rating=1866
# gear_mastery_rating=7262
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

appendages_880 / pod_880 : 314826 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
314825.8 314825.8 402.1 / 0.128% 40431.3 / 12.8% 21110.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.9 14.9 Energy 30.55% 44.2 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
appendages_880 / pod_880 314826
Ashamane's Frenzy 14438 4.6% 6.1 78.51sec 1062632 1057965 Direct 91.4 9880 19757 13217 33.8%  
Periodic 30.2 130628 261617 174862 33.8% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.11 91.39 121.62 30.22 1.0045 0.6473 6492728.70 7060575.31 8.04 76506.55 1057964.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.51 66.21% 9880.18 7359 11728 9881.81 8898 10760 597845 878888 31.98
crit 30.88 33.79% 19756.84 14718 23457 19762.88 17270 21924 610096 896899 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.0 66.24% 130627.70 81137 161643 130676.49 119004 144174 2615072 2615072 0.00
crit 10.2 33.76% 261616.96 166330 323286 261718.85 220423 300540 2669715 2669715 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 35777 11.4% 18.5 23.02sec 868741 0 Periodic 145.7 82653 165179 110514 33.8% 41.7%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.53 0.00 145.66 145.66 0.0000 1.2889 16096911.21 16096911.21 0.00 85740.90 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.5 66.24% 82653.38 57 97912 82569.72 72247 90487 7975051 7975051 0.00
crit 49.2 33.76% 165178.74 115 195823 165018.61 141774 182319 8121860 8121860 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 27951 8.9% 515.4 0.87sec 24394 28020 Direct 515.4 18234 36471 24395 33.8%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 515.42 515.42 0.00 0.00 0.8706 0.0000 12573197.83 18483791.77 31.98 28019.77 28019.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 341.31 66.22% 18233.70 14216 20436 18233.50 17892 18539 6223404 9148994 31.98
crit 174.11 33.78% 36470.98 28433 40872 36470.77 35572 37296 6349794 9334798 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6333 2.0% 10.6 44.37sec 267866 266682 Direct 10.6 190349 419912 267840 33.8%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.62 10.62 0.00 0.00 1.0045 0.0000 2845765.13 4183544.30 31.98 266682.14 266682.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.04 66.24% 190349.09 14564 251221 189964.63 69171 243029 1339388 1969027 31.98
crit 3.59 33.76% 419911.99 32246 555198 411767.73 0 555198 1506378 2214518 31.45
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Horrific Slam 8150 2.6% 100.9 3.55sec 36346 0 Direct 100.9 27146 54324 36347 33.9%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.88 100.88 0.00 0.00 0.0000 0.0000 3666646.17 3666646.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.73 66.15% 27146.36 21142 30392 27147.90 24465 29203 1811477 1811477 0.00
crit 34.15 33.85% 54324.42 42285 60784 54327.96 48628 59463 1855169 1855169 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Infested Ground 6066 1.9% 7.9 60.67sec 347150 0 Direct 77.7 26268 52521 35131 33.8%  

Stats details: infested_ground

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.86 77.66 0.00 0.00 0.0000 0.0000 2728165.09 2728165.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.44 66.24% 26268.18 19237 27653 26267.71 24933 27092 1351135 1351135 0.00
crit 26.22 33.76% 52520.85 38474 55306 52522.37 47955 54650 1377030 1377030 0.00
 
 

Action details: infested_ground

Static Values
  • id:221803
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221803
  • name:Infested Ground
  • school:shadow
  • tooltip:
  • description:Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.
 
Moonfire (lunar_inspiration) 22353 7.1% 31.6 14.33sec 318128 316712 Direct 31.6 33007 66117 44150 33.7%  
Periodic 254.0 25478 50969 34098 33.8% 96.9%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.61 31.61 253.96 253.96 1.0045 1.7169 10054959.09 10054959.09 0.00 21495.52 316711.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.97 66.34% 33007.19 25727 36982 33002.71 31058 34570 692125 692125 0.00
crit 10.64 33.66% 66116.70 51454 73964 66098.49 57885 73964 703329 703329 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 168.1 66.18% 25478.05 476 28764 25477.90 24460 26088 4282430 4282430 0.00
crit 85.9 33.82% 50969.40 951 57529 50967.32 48721 52627 4377076 4377076 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2238 0.7% 24.7 18.12sec 40732 0 Periodic 73.1 13771 0 13771 0.0% 8.1%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.70 0.00 73.06 73.06 0.0000 0.4970 1006135.30 1479114.20 31.98 27708.83 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.1 100.00% 13771.17 25 15493 13774.18 12770 14536 1006135 1479114 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11398 3.6% 24.2 17.00sec 209341 0 Direct 24.2 156664 313055 209334 33.7%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.18 24.18 0.00 0.00 0.0000 0.0000 5061473.68 7440845.75 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.03 66.32% 156663.62 122075 175482 156667.10 142616 170904 2512015 3692900 31.98
crit 8.14 33.68% 313055.11 244149 350964 312845.17 0 350964 2549459 3747946 31.96
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 68594 21.8% 47.3 9.55sec 652686 649763 Direct 47.3 84694 169092 113229 33.8%  
Periodic 223.7 85209 170566 114026 33.8% 94.9%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.28 47.28 223.68 223.68 1.0045 1.9092 30858565.46 30858565.46 0.00 65028.24 649763.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.29 66.19% 84694.48 39787 190234 84720.90 72864 94308 2650205 2650205 0.00
crit 15.99 33.81% 169092.20 79574 380468 169130.39 132822 226465 2703423 2703423 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.2 66.24% 85208.89 37 190234 85231.09 77174 94083 12624924 12624924 0.00
crit 75.5 33.76% 170566.05 158 380468 170610.61 145686 200342 12880014 12880014 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 82474 26.2% 22.9 15.52sec 1623252 1615984 Periodic 326.5 84988 169982 113686 33.8% 96.1%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.87 0.00 326.50 326.50 1.0045 1.3247 37119152.93 37119152.93 0.00 81493.87 1615984.02
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 216.3 66.23% 84988.44 66 97912 84980.04 79306 88973 18379245 18379245 0.00
crit 110.2 33.77% 169982.32 115 195823 169963.04 156151 180656 18739908 18739908 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 29054 9.2% 110.3 4.07sec 118324 117794 Direct 110.3 88449 176823 118325 33.8%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.34 110.34 0.00 0.00 1.0045 0.0000 13056322.39 19194030.64 31.98 117794.32 117794.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.04 66.19% 88449.03 61977 133637 88467.64 81424 94590 6460413 9497419 31.98
crit 37.30 33.81% 176822.90 123954 267275 176748.04 161460 195093 6595910 9696612 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
appendages_880 / pod_880
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:appendages_880 / pod_880
  • harmful:false
  • if_expr:
 
Berserk 3.0 181.97sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:appendages_880 / pod_880
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:appendages_880 / pod_880
  • harmful:false
  • if_expr:
 
Healing Touch 50.3 9.04sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.29 0.00 0.00 0.00 0.8644 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.6 24.69sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.57 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.80sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.34sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.19% 45.4(45.4) 15.1

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 14.87% 0.0(0.0) 2.9

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 50.3 0.0 9.0sec 9.0sec 45.59% 45.63% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.74%
  • bloodtalons_2:26.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 43.8 1.4 10.1sec 9.8sec 6.34% 15.27% 1.4(1.4) 0.0

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.34%

Trigger Attempt Success

  • trigger_pct:8.78%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Horrific Appendages 5.7 1.0 72.0sec 59.7sec 17.03% 17.12% 101.9(101.9) 5.6

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:17.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Jacin's Ruse 6.6 1.9 63.9sec 48.2sec 24.77% 24.86% 1.9(1.9) 6.4

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Leeching Pestilence 7.9 0.0 60.7sec 60.7sec 17.28% 17.37% 0.0(0.0) 7.7

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_leeching_pestilence
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:leech_rating
  • amount:2037.36

Stack Uptimes

  • leeching_pestilence_1:17.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221805
  • name:Leeching Pestilence
  • tooltip:Leech increased by $w1.
  • description:{$@spelldesc221803=Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.0sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 50.0 1.2 9.0sec 8.8sec 74.57% 74.58% 1.2(1.2) 0.0

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.57%

Trigger Attempt Success

  • trigger_pct:98.42%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.2 10.3 47.7sec 24.7sec 93.35% 93.07% 202.1(202.1) 7.2

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.7sec 133.7sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.81% 29.12% 0.0(0.0) 14.9

Buff details

  • buff initial source:appendages_880 / pod_880
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
appendages_880 / pod_880
ferocious_bite Energy 21.2 360.2 17.0 33.9 7900.5
ferocious_bite Combo Points 10.6 49.0 4.6 4.6 58067.4
lunar_inspiration Energy 31.6 781.2 24.7 24.7 12870.9
rake Energy 47.3 1343.3 28.4 28.4 22972.0
rip Energy 22.9 465.9 20.4 20.4 79666.9
rip Combo Points 22.9 114.3 5.0 5.0 324648.2
savage_roar Energy 18.6 479.0 25.8 25.8 0.0
savage_roar Combo Points 18.6 92.8 5.0 5.0 0.0
shred Energy 110.3 3276.0 29.7 29.7 3985.5
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.28 47.28 (18.23%) 1.00 0.00 0.00%
tigers_fury Energy 15.21 912.41 (11.18%) 59.97 0.47 0.05%
ashamanes_frenzy Combo Points 6.11 18.33 (7.07%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.61 31.61 (12.19%) 1.00 0.00 0.00%
shred Combo Points 110.35 110.35 (42.54%) 1.00 0.00 0.00%
energy_regen Energy 2166.08 5090.38 (62.38%) 2.35 72.91 1.41%
clearcasting Energy 43.75 1495.49 (18.33%) 34.18 0.00 0.00%
ashamanes_energy Energy 45.44 662.12 (8.11%) 14.57 19.51 2.86%
primal_fury Combo Points 63.93 51.83 (19.98%) 0.81 12.10 18.93%
Resource RPS-Gain RPS-Loss
Energy 14.81 14.90
Combo Points 0.58 0.57
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 34.70 0.08 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.21 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.9%

Procs

Count Interval
clearcasting 45.2 9.8sec
clearcasting_wasted 1.4 123.1sec
primal_fury 63.9 7.0sec

Statistics & Data Analysis

Fight Length
Sample Data appendages_880 / pod_880 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data appendages_880 / pod_880 Damage Per Second
Count 2499
Mean 314825.82
Minimum 282310.10
Maximum 350603.26
Spread ( max - min ) 68293.16
Range [ ( max - min ) / 2 * 100% ] 10.85%
Standard Deviation 10254.9670
5th Percentile 297887.46
95th Percentile 331604.40
( 95th Percentile - 5th Percentile ) 33716.93
Mean Distribution
Standard Deviation 205.1404
95.00% Confidence Intervall ( 314423.76 - 315227.89 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4075
0.1 Scale Factor Error with Delta=300 897743
0.05 Scale Factor Error with Delta=300 3590973
0.01 Scale Factor Error with Delta=300 89774335
Priority Target DPS
Sample Data appendages_880 / pod_880 Priority Target Damage Per Second
Count 2499
Mean 314825.82
Minimum 282310.10
Maximum 350603.26
Spread ( max - min ) 68293.16
Range [ ( max - min ) / 2 * 100% ] 10.85%
Standard Deviation 10254.9670
5th Percentile 297887.46
95th Percentile 331604.40
( 95th Percentile - 5th Percentile ) 33716.93
Mean Distribution
Standard Deviation 205.1404
95.00% Confidence Intervall ( 314423.76 - 315227.89 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4075
0.1 Scale Factor Error with Delta=300 897743
0.05 Scale Factor Error with Delta=300 3590973
0.01 Scale Factor Error with Delta=300 89774335
DPS(e)
Sample Data appendages_880 / pod_880 Damage Per Second (Effective)
Count 2499
Mean 314825.82
Minimum 282310.10
Maximum 350603.26
Spread ( max - min ) 68293.16
Range [ ( max - min ) / 2 * 100% ] 10.85%
Damage
Sample Data appendages_880 / pod_880 Damage
Count 2499
Mean 141560022.98
Minimum 106875344.46
Maximum 177370675.42
Spread ( max - min ) 70495330.95
Range [ ( max - min ) / 2 * 100% ] 24.90%
DTPS
Sample Data appendages_880 / pod_880 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data appendages_880 / pod_880 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data appendages_880 / pod_880 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data appendages_880 / pod_880 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data appendages_880 / pod_880 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data appendages_880 / pod_880 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data appendages_880 / pod_880Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data appendages_880 / pod_880 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.56 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.56 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 7.86 use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
C 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
D 15.22 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
E 3.96 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
F 49.29 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
J 8.24 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
K 22.87 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
L 10.32 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
M 6.66 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
N 6.11 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
O 3.56 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
P 42.72 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
Q 31.61 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
R 110.35 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789QRDABRRJRFNKRPQFMPRRFKRRRRRFLPQPFDKO89RRRFMQRRFKPRQRFPDBJPRRQRFKPRRFKNPQFJDPRRRFKPQRRFLPRQRFKDBPRRRFKPQRRFJPQPDRFKO89RRQFKNRRFJPQPFRKDABRRRQFKPRRFLRPRFMRQRFKPRRDRQFKPRRFJPRRRQFKPRFNLPQDBRRFKRRRFMPQRFKPQRDRFJO89RRRFKQRRRFLPPRFKQDBPRFKRRRFLNPQFMPRQFKPDRRRFKPQRRFJPQRFEPDABCRRRFLPQRRRERRRFMPRQRFLNPFMDRRQRFMPRQFLPRREDBQRPRFLPRRRFEPQR

Sample Sequence Table

time name target resources buffs
Pre flask appendages_880 / pod_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food appendages_880 / pod_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation appendages_880 / pod_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, jacins_ruse, potion_of_the_old_war
0:01.004 lunar_inspiration Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, jacins_ruse, potion_of_the_old_war
0:02.009 shred Fluffy_Pillow 61.2/100: 61% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, jacins_ruse, potion_of_the_old_war
0:03.013 tigers_fury Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, jacins_ruse, potion_of_the_old_war
0:03.013 berserk Fluffy_Pillow 95.8/100: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, tigers_fury, jacins_ruse, potion_of_the_old_war
0:03.013 use_item_ravaged_seed_pod Fluffy_Pillow 95.8/150: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, jacins_ruse, potion_of_the_old_war
0:03.013 shred Fluffy_Pillow 95.8/150: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:04.020 shred Fluffy_Pillow 105.4/150: 70% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:05.025 savage_roar Fluffy_Pillow 115.0/150: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:06.029 shred Fluffy_Pillow 124.6/150: 83% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:07.035 healing_touch Fluffy_Pillow 119.3/150: 80% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:07.790 ashamanes_frenzy Fluffy_Pillow 130.2/150: 87% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:08.795 rip Fluffy_Pillow 144.9/150: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:09.799 shred Fluffy_Pillow 144.4/150: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:10.803 rake Fluffy_Pillow 139.0/150: 93% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:11.806 lunar_inspiration Fluffy_Pillow 136.1/150: 91% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:12.811 healing_touch Fluffy_Pillow 135.7/150: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:13.565 ferocious_bite Fluffy_Pillow 146.7/150: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
0:14.569 rake Fluffy_Pillow 148.8/150: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:15.575 shred Fluffy_Pillow 145.9/150: 97% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:16.578 shred Fluffy_Pillow 140.5/150: 94% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:17.582 healing_touch Fluffy_Pillow 135.1/150: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:18.336 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, jacins_ruse, potion_of_the_old_war
0:19.339 shred Fluffy_Pillow 84.6/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:20.341 shred Fluffy_Pillow 59.1/100: 59% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:21.346 shred Fluffy_Pillow 73.8/100: 74% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse, potion_of_the_old_war
0:22.351 shred Fluffy_Pillow 48.4/100: 48% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse, potion_of_the_old_war
0:23.354 shred Fluffy_Pillow 62.9/100: 63% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
0:24.359 healing_touch Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
0:25.112 Waiting 1.100 sec 48.5/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
0:26.212 savage_roar Fluffy_Pillow 64.5/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
0:27.218 rake Fluffy_Pillow 39.1/100: 39% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
0:28.221 Waiting 0.833 sec 18.7/100: 19% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
0:29.054 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
0:30.060 Waiting 0.658 sec 15.4/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
0:31.485 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
0:32.491 healing_touch Fluffy_Pillow 15.8/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:33.245 tigers_fury Fluffy_Pillow 26.7/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:33.245 rip Fluffy_Pillow 86.7/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:34.249 shadowmeld Fluffy_Pillow 86.3/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.249 rake Fluffy_Pillow 86.3/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.249 auto_attack Fluffy_Pillow 51.3/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.254 shred Fluffy_Pillow 80.9/100: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.258 shred Fluffy_Pillow 70.5/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:37.265 shred Fluffy_Pillow 45.2/100: 45% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury
0:38.270 healing_touch Fluffy_Pillow 59.8/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.024 Waiting 1.100 sec 70.7/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:40.124 ferocious_bite Fluffy_Pillow 86.7/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:41.128 lunar_inspiration Fluffy_Pillow 49.0/100: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:42.131 shred Fluffy_Pillow 60.2/100: 60% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
0:43.134 Waiting 0.800 sec 31.4/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:43.934 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:44.939 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:45.836 Waiting 0.801 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:46.637 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:49.429 rake Fluffy_Pillow 31.8/100: 32% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
0:50.434 shred Fluffy_Pillow 43.0/100: 43% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
0:51.439 Waiting 1.458 sec 14.3/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:52.897 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:53.901 Waiting 2.578 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
0:56.479 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
0:57.483 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
0:58.380 Waiting 1.177 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2)
0:59.557 rake Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2)
1:03.113 tigers_fury Fluffy_Pillow 39.8/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons
1:03.245 use_item_ravaged_seed_pod Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, tigers_fury
1:03.245 savage_roar Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, tigers_fury, leeching_pestilence
1:04.249 rake Fluffy_Pillow 86.2/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:05.255 shred Fluffy_Pillow 77.5/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:06.259 shred Fluffy_Pillow 63.7/100: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:07.263 lunar_inspiration Fluffy_Pillow 34.9/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:08.266 shred Fluffy_Pillow 16.1/100: 16% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:09.270 healing_touch Fluffy_Pillow 27.4/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:10.169 rip Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
1:12.708 rake Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, leeching_pestilence
1:13.715 Waiting 2.555 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:16.270 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:17.274 Waiting 2.573 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:19.847 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:20.852 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:21.750 Waiting 2.574 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:24.324 rip Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:25.329 ashamanes_frenzy Fluffy_Pillow 31.9/100: 32% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:26.336 rake Fluffy_Pillow 43.2/100: 43% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:27.341 Waiting 0.996 sec 19.4/100: 19% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:28.337 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:29.342 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
1:32.030 savage_roar Fluffy_Pillow 41.9/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
1:33.035 tigers_fury Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:33.245 rake Fluffy_Pillow 75.5/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:34.252 shred Fluffy_Pillow 66.7/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.256 shred Fluffy_Pillow 53.0/100: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:36.261 Waiting 0.100 sec 39.2/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
1:36.361 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
1:37.365 healing_touch Fluffy_Pillow 11.5/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:38.262 Waiting 3.007 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:41.269 rip Fluffy_Pillow 55.2/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:42.273 rake Fluffy_Pillow 66.4/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:43.278 lunar_inspiration Fluffy_Pillow 42.7/100: 43% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:44.282 Waiting 1.500 sec 23.9/100: 24% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:45.782 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:46.787 shred Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
1:47.792 healing_touch Fluffy_Pillow 23.1/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
1:48.690 savage_roar Fluffy_Pillow 33.2/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:49.693 rake Fluffy_Pillow 44.4/100: 44% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:50.697 Waiting 1.792 sec 20.6/100: 21% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:52.489 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:53.493 Waiting 1.673 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:55.166 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:56.170 Waiting 2.579 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:58.749 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:59.754 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:00.653 Waiting 0.773 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:01.426 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:03.196 tigers_fury Fluffy_Pillow 20.4/100: 20% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:03.245 use_item_ravaged_seed_pod Fluffy_Pillow 80.9/100: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:03.245 rake Fluffy_Pillow 80.9/100: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:04.250 shred Fluffy_Pillow 72.2/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:05.256 shred Fluffy_Pillow 58.4/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:06.260 shred Fluffy_Pillow 44.6/100: 45% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:07.265 healing_touch Fluffy_Pillow 15.9/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:08.162 Waiting 3.700 sec 25.9/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:11.862 rip Fluffy_Pillow 67.3/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, leeching_pestilence, jacins_ruse
2:12.865 rake Fluffy_Pillow 48.5/100: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
2:13.869 Waiting 0.500 sec 24.7/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:14.369 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:15.374 Waiting 2.602 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:17.976 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:18.980 Waiting 2.573 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:21.553 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
2:22.556 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
2:25.242 savage_roar Fluffy_Pillow 41.9/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
2:28.294 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:29.299 Waiting 1.138 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:30.437 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
2:31.441 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:32.445 Waiting 1.122 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:33.567 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:33.567 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:34.571 healing_touch Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:35.470 rip Fluffy_Pillow 81.3/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:36.474 shadowmeld Fluffy_Pillow 77.5/100: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:36.474 rake Fluffy_Pillow 77.5/100: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:36.474 auto_attack Fluffy_Pillow 42.5/100: 43% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:37.478 shred Fluffy_Pillow 68.7/100: 69% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
2:38.484 Waiting 0.100 sec 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
2:38.584 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
2:39.591 Waiting 1.630 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
2:41.221 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
2:42.225 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:43.125 Waiting 1.479 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:44.604 rip Fluffy_Pillow 38.4/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:45.610 ashamanes_frenzy Fluffy_Pillow 49.7/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:46.616 shred Fluffy_Pillow 60.9/100: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:47.620 Waiting 0.800 sec 32.1/100: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:48.420 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:49.424 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
2:52.105 savage_roar Fluffy_Pillow 42.3/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
2:55.152 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:56.157 Waiting 1.608 sec 12.6/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:57.765 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:01.070 rake Fluffy_Pillow 37.5/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
3:02.074 Waiting 1.004 sec 13.8/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
3:03.078 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
3:03.976 shred Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages
3:04.980 rip Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, horrific_appendages
3:05.983 tigers_fury Fluffy_Pillow 27.5/100: 27% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, horrific_appendages
3:05.983 berserk Fluffy_Pillow 87.5/100: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:05.983 use_item_ravaged_seed_pod Fluffy_Pillow 87.5/150: 58% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:05.983 shred Fluffy_Pillow 87.5/150: 58% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:06.987 shred Fluffy_Pillow 93.7/150: 62% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:07.989 shred Fluffy_Pillow 99.9/150: 67% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:08.993 lunar_inspiration Fluffy_Pillow 106.1/150: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:09.996 healing_touch Fluffy_Pillow 102.3/150: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:10.894 rip Fluffy_Pillow 112.4/150: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence
3:11.899 rake Fluffy_Pillow 108.6/150: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:12.903 shred Fluffy_Pillow 102.4/150: 68% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:13.908 shred Fluffy_Pillow 93.6/150: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:14.912 healing_touch Fluffy_Pillow 84.8/150: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence
3:15.811 savage_roar Fluffy_Pillow 94.9/150: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, leeching_pestilence
3:16.816 shred Fluffy_Pillow 86.1/150: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar
3:17.821 rake Fluffy_Pillow 77.3/150: 52% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:18.824 shred Fluffy_Pillow 71.1/150: 47% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:19.830 healing_touch Fluffy_Pillow 62.3/150: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:20.728 ferocious_bite Fluffy_Pillow 72.4/150: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:21.732 shred Fluffy_Pillow 58.6/100: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:22.735 Waiting 0.100 sec 29.8/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:22.835 lunar_inspiration Fluffy_Pillow 30.9/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:23.840 Waiting 2.548 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:26.388 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:27.392 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:28.291 Waiting 1.174 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:29.465 rip Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:30.471 rake Fluffy_Pillow 16.3/100: 16% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
3:31.477 Waiting 1.200 sec 27.6/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:32.677 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:33.681 Waiting 1.144 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:34.825 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
3:35.831 tigers_fury Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:35.983 shred Fluffy_Pillow 97.9/100: 98% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:36.988 lunar_inspiration Fluffy_Pillow 84.2/100: 84% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:37.992 healing_touch Fluffy_Pillow 80.4/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:38.890 rip Fluffy_Pillow 90.4/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
3:39.895 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
3:40.899 shred Fluffy_Pillow 76.2/100: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
3:41.904 shred Fluffy_Pillow 47.5/100: 47% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, tigers_fury, jacins_ruse
3:42.907 healing_touch Fluffy_Pillow 58.7/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, jacins_ruse
3:43.806 savage_roar Fluffy_Pillow 68.7/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), tigers_fury, jacins_ruse
3:44.812 rake Fluffy_Pillow 80.0/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
3:45.817 shred Fluffy_Pillow 56.2/100: 56% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:46.822 shred Fluffy_Pillow 67.5/100: 67% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:47.826 Waiting 0.200 sec 38.7/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:48.026 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:49.032 Waiting 1.647 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:50.679 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:51.683 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:52.582 Waiting 3.880 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:56.462 rip Fluffy_Pillow 65.3/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:57.467 rake Fluffy_Pillow 46.5/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:58.471 Waiting 1.203 sec 22.7/100: 23% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:59.674 shred Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
4:00.678 healing_touch Fluffy_Pillow 47.4/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:01.575 ashamanes_frenzy Fluffy_Pillow 57.4/100: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar
4:02.579 Waiting 0.500 sec 68.7/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
4:03.079 savage_roar Fluffy_Pillow 74.2/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
4:04.084 rake Fluffy_Pillow 45.5/100: 45% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:05.088 lunar_inspiration Fluffy_Pillow 21.7/100: 22% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
4:06.093 tigers_fury Fluffy_Pillow 33.0/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:06.093 use_item_ravaged_seed_pod Fluffy_Pillow 93.0/100: 93% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:06.093 shred Fluffy_Pillow 93.0/100: 93% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:07.097 shred Fluffy_Pillow 79.2/100: 79% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:08.102 healing_touch Fluffy_Pillow 65.4/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:09.000 Waiting 0.100 sec 75.5/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
4:09.100 rip Fluffy_Pillow 91.6/100: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
4:10.103 shred Fluffy_Pillow 72.8/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:11.107 shred Fluffy_Pillow 44.0/100: 44% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:12.112 Waiting 0.971 sec 15.3/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:13.083 shred Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:14.088 healing_touch Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:14.986 Waiting 3.800 sec 47.4/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, leeching_pestilence
4:18.786 ferocious_bite Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:19.791 rake Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:20.795 Waiting 0.300 sec 27.4/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:21.095 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:22.099 Waiting 2.568 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:24.667 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:25.671 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:26.571 Waiting 1.773 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:28.344 rip Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:30.622 rake Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:31.627 Waiting 1.030 sec 13.5/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:32.657 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness
4:33.664 Waiting 0.400 sec 36.3/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:34.064 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:35.067 Waiting 1.167 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
4:36.234 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
4:36.234 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:37.239 healing_touch Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:38.138 savage_roar Fluffy_Pillow 81.3/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
4:39.144 shadowmeld Fluffy_Pillow 67.5/100: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:39.144 rake Fluffy_Pillow 67.5/100: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:39.144 auto_attack Fluffy_Pillow 32.5/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:40.149 shred Fluffy_Pillow 58.8/100: 59% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:41.153 shred Fluffy_Pillow 30.0/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
4:42.157 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:43.161 healing_touch Fluffy_Pillow 12.5/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:44.061 Waiting 2.022 sec 22.5/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:46.083 rip Fluffy_Pillow 45.1/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:47.088 Waiting 0.200 sec 26.4/100: 26% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:47.288 lunar_inspiration Fluffy_Pillow 28.6/100: 29% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:48.291 Waiting 0.100 sec 39.8/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:48.391 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:49.396 shred Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
4:50.400 shred Fluffy_Pillow 23.4/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
4:51.406 healing_touch Fluffy_Pillow 34.6/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:52.304 savage_roar Fluffy_Pillow 44.7/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:55.095 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:56.098 Waiting 2.052 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:58.150 rake Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:59.153 shred Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
5:00.158 healing_touch Fluffy_Pillow 22.5/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:01.056 Waiting 1.200 sec 32.6/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:02.256 rip Fluffy_Pillow 46.0/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:03.258 Waiting 0.300 sec 27.2/100: 27% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:03.558 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:06.099 tigers_fury Fluffy_Pillow 28.9/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:06.234 use_item_ravaged_seed_pod Fluffy_Pillow 90.5/100: 90% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:06.234 rake Fluffy_Pillow 90.5/100: 90% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:07.239 shred Fluffy_Pillow 81.7/100: 82% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:08.243 healing_touch Fluffy_Pillow 67.9/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:09.142 Waiting 0.100 sec 78.0/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
5:09.242 rip Fluffy_Pillow 94.1/100: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
5:10.248 shred Fluffy_Pillow 75.3/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:11.252 shred Fluffy_Pillow 86.6/100: 87% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:12.257 shred Fluffy_Pillow 57.8/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:13.262 healing_touch Fluffy_Pillow 29.0/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:14.161 Waiting 1.300 sec 39.1/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:15.461 savage_roar Fluffy_Pillow 53.6/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages, leeching_pestilence
5:16.465 ashamanes_frenzy Fluffy_Pillow 64.9/100: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages
5:17.580 rake Fluffy_Pillow 77.3/100: 77% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
5:18.583 lunar_inspiration Fluffy_Pillow 53.5/100: 54% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages
5:19.588 healing_touch Fluffy_Pillow 64.8/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:20.487 Waiting 1.300 sec 74.8/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
5:21.787 ferocious_bite Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
5:22.792 rake Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
5:23.798 Waiting 1.200 sec 26.9/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:24.998 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:26.004 Waiting 2.404 sec 11.5/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:28.408 lunar_inspiration Fluffy_Pillow 38.4/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:29.412 healing_touch Fluffy_Pillow 19.6/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:30.310 Waiting 0.100 sec 29.7/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:30.410 rip Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:33.719 rake Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:34.724 Waiting 1.280 sec 14.0/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:36.004 tigers_fury Fluffy_Pillow 28.3/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:36.234 shred Fluffy_Pillow 90.9/100: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:37.237 shred Fluffy_Pillow 77.1/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:38.241 shred Fluffy_Pillow 63.4/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:39.246 healing_touch Fluffy_Pillow 49.6/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:40.143 Waiting 2.700 sec 59.6/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:42.843 rip Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:43.848 rake Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:44.853 lunar_inspiration Fluffy_Pillow 47.3/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:45.857 Waiting 1.100 sec 28.5/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:46.957 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
5:47.961 Waiting 2.557 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
5:50.518 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
5:51.521 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness
5:52.419 savage_roar Fluffy_Pillow 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
5:53.680 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:54.684 Waiting 1.741 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:56.425 lunar_inspiration Fluffy_Pillow 31.7/100: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:57.430 Waiting 1.078 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
5:58.508 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
5:59.512 healing_touch Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
6:00.411 ferocious_bite Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
6:03.713 rake Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
6:04.717 Waiting 1.359 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
6:06.076 tigers_fury Fluffy_Pillow 28.3/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
6:06.234 berserk Fluffy_Pillow 90.1/100: 90% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
6:06.234 use_item_ravaged_seed_pod Fluffy_Pillow 90.1/150: 60% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
6:06.234 potion Fluffy_Pillow 90.1/150: 60% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence, jacins_ruse
6:06.234 shred Fluffy_Pillow 90.1/150: 60% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:07.237 shred Fluffy_Pillow 96.3/150: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:08.242 shred Fluffy_Pillow 102.6/150: 68% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:09.246 healing_touch Fluffy_Pillow 128.8/150: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:10.145 savage_roar Fluffy_Pillow 138.8/150: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:11.149 rake Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:12.155 lunar_inspiration Fluffy_Pillow 143.7/150: 96% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:13.161 shred Fluffy_Pillow 140.0/150: 93% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:14.165 shred Fluffy_Pillow 131.2/150: 87% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:15.169 shred Fluffy_Pillow 122.5/150: 82% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
6:16.175 ferocious_bite Fluffy_Pillow 113.7/150: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
6:17.180 shred Fluffy_Pillow 99.9/150: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:18.185 shred Fluffy_Pillow 91.2/150: 61% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:19.188 shred Fluffy_Pillow 102.4/150: 68% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:20.192 healing_touch Fluffy_Pillow 93.6/150: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:21.092 ferocious_bite Fluffy_Pillow 103.7/150: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:22.098 rake Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:23.102 shred Fluffy_Pillow 66.2/100: 66% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:24.108 Waiting 0.300 sec 37.4/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:24.408 lunar_inspiration Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:25.413 Waiting 1.668 sec 22.0/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:27.081 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:28.085 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:28.984 Waiting 1.674 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:30.658 savage_roar Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, potion_of_the_old_war
6:31.663 ashamanes_frenzy Fluffy_Pillow 51.9/100: 52% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:32.667 rake Fluffy_Pillow 63.1/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
6:33.672 healing_touch Fluffy_Pillow 39.4/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:34.570 Waiting 0.100 sec 49.4/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:34.670 ferocious_bite Fluffy_Pillow 50.5/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:35.673 Waiting 1.186 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:36.859 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:36.859 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:37.863 shred Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:38.868 lunar_inspiration Fluffy_Pillow 57.5/100: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:39.872 shred Fluffy_Pillow 53.7/100: 54% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
6:40.875 healing_touch Fluffy_Pillow 24.9/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
6:41.774 Waiting 4.900 sec 35.0/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
6:46.674 ferocious_bite Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:47.679 rake Fluffy_Pillow 51.0/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:48.683 Waiting 1.200 sec 27.2/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:49.883 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:50.887 Waiting 1.675 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:52.562 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:53.567 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:54.465 Waiting 1.780 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:56.245 savage_roar Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
6:59.293 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages
7:00.297 Waiting 1.155 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
7:01.452 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
7:02.456 Waiting 0.400 sec 36.2/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
7:02.856 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
7:03.861 Waiting 1.268 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
7:05.129 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
7:06.134 Waiting 1.230 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, horrific_appendages
7:07.364 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:07.364 use_item_ravaged_seed_pod Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:07.364 lunar_inspiration Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:08.368 shred Fluffy_Pillow 81.2/100: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:09.372 rake Fluffy_Pillow 67.4/100: 67% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:10.375 shred Fluffy_Pillow 58.7/100: 59% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:11.380 healing_touch Fluffy_Pillow 29.9/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:12.279 Waiting 3.100 sec 40.0/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
7:15.379 savage_roar Fluffy_Pillow 74.6/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, leeching_pestilence
7:16.383 rake Fluffy_Pillow 85.8/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, leeching_pestilence
7:17.388 shred Fluffy_Pillow 62.1/100: 62% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
7:18.391 shred Fluffy_Pillow 73.3/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:19.397 shred Fluffy_Pillow 44.5/100: 45% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:20.402 healing_touch Fluffy_Pillow 15.8/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:21.298 ferocious_bite Fluffy_Pillow 25.8/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:22.302 Waiting 1.231 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:24.553 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:25.559 Waiting 1.604 sec 12.6/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:27.163 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:28.168 Waiting 1.178 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:29.346 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 33.77% 33.77% 6220
Haste 11.82% 11.82% 3842
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 21649 19943 0
Mastery 57.66% 55.50% 6914
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 849.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Trinket2 Ravaged Seed Pod
ilevel: 880, stats: { +1043 Haste }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="appendages_880 / pod_880"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=spontaneous_appendages,id=139325,bonus_id=1806
trinket2=ravaged_seed_pod,id=139320,bonus_id=1806
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=848.75
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=6220
# gear_haste_rating=2561
# gear_mastery_rating=6914
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

arcanocrystal_860 / appendages_880 : 324905 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
324904.8 324904.8 426.5 / 0.131% 42480.7 / 13.1% 21943.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.8 14.8 Energy 30.73% 43.0 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcanocrystal_860 / appendages_880 324905
Ashamane's Frenzy 15369 4.7% 6.1 78.52sec 1132255 1127352 Direct 91.4 10354 20708 14104 36.2%  
Periodic 30.2 136959 273928 186235 36.0% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.11 91.36 121.57 30.21 1.0045 0.6472 6914048.23 7519799.56 8.06 81518.21 1127351.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.27 63.78% 10354.14 7718 12267 10355.68 9465 11272 603400 887056 31.98
crit 33.09 36.22% 20708.05 15437 24534 20711.69 18068 22784 685172 1007268 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.3 64.02% 136958.79 85099 169065 136995.00 124796 153928 2648666 2648666 0.00
crit 10.9 35.98% 273928.25 170198 338130 273964.84 228456 315304 2976810 2976810 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 38151 11.7% 18.4 22.95sec 930805 0 Periodic 145.6 86719 173366 117859 35.9% 41.7%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.43 0.00 145.57 145.57 0.0000 1.2892 17156753.75 17156753.75 0.00 91419.80 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.3 64.06% 86719.49 60 102407 86627.09 72547 93802 8087364 8087364 0.00
crit 52.3 35.94% 173366.33 120 204815 173159.74 147740 188824 9069390 9069390 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 28695 8.8% 510.3 0.88sec 25292 28762 Direct 510.3 18594 37187 25292 36.0%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 510.31 510.31 0.00 0.00 0.8793 0.0000 12906796.23 18974213.02 31.98 28762.30 28762.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 326.49 63.98% 18594.49 14488 20826 18594.30 18208 18907 6070961 8924888 31.98
crit 183.82 36.02% 37187.39 28976 41653 37187.63 36336 37949 6835835 10049325 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6685 2.1% 10.7 43.60sec 280541 279297 Direct 10.7 194657 431161 280538 36.3%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.71 10.71 0.00 0.00 1.0045 0.0000 3004673.88 4417155.22 31.98 279296.70 279296.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.82 63.68% 194656.57 14884 256019 193979.22 0 247671 1327624 1951734 31.96
crit 3.89 36.32% 431160.70 34239 565803 425654.32 0 565803 1677049 2465422 31.66
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Horrific Slam 8307 2.6% 99.1 3.62sec 37702 0 Direct 99.1 27698 55387 37701 36.1%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.15 99.15 0.00 0.00 0.0000 0.0000 3738033.05 3738033.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.32 63.87% 27698.06 21546 30973 27699.76 24665 29697 1753928 1753928 0.00
crit 35.82 36.13% 55387.37 43092 61945 55394.22 45786 60476 1984105 1984105 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Moonfire (lunar_inspiration) 22941 7.1% 31.6 14.35sec 326850 325393 Direct 31.6 33647 67336 45818 36.1%  
Periodic 251.9 25890 51773 35225 36.1% 96.8%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.57 31.57 251.91 251.91 1.0045 1.7292 10320160.40 10320160.40 0.00 22083.81 325392.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.17 63.87% 33647.36 26218 37689 33645.76 31638 35395 678575 678575 0.00
crit 11.41 36.13% 67335.89 52436 75377 67315.33 60302 73411 768151 768151 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 161.1 63.93% 25889.99 158 29314 25889.86 24986 26572 4169723 4169723 0.00
crit 90.9 36.07% 51773.43 316 58627 51774.47 49002 53580 4703712 4703712 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2233 0.7% 24.2 18.49sec 41540 0 Periodic 71.5 14044 0 14044 0.0% 7.9%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.19 0.00 71.54 71.54 0.0000 0.4971 1004738.59 1477060.89 31.98 28252.36 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.5 100.00% 14044.05 32 15789 14047.82 13099 14849 1004739 1477061 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11582 3.5% 23.7 17.42sec 216588 0 Direct 23.7 159670 319369 216585 35.6%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.74 23.74 0.00 0.00 0.0000 0.0000 5141766.40 7558883.65 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.28 64.36% 159669.80 124406 178834 159653.17 145938 170087 2439602 3586447 31.98
crit 8.46 35.64% 319369.02 248812 357668 319319.59 273694 357668 2702164 3972437 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 73249 22.6% 47.3 9.54sec 697360 694250 Direct 47.3 88971 177630 120916 36.0%  
Periodic 223.5 89499 179192 121886 36.1% 94.8%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.26 47.26 223.49 223.49 1.0045 1.9097 32953978.32 32953978.32 0.00 69485.49 694250.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.23 63.97% 88971.08 41730 198969 88987.57 76117 102215 2689575 2689575 0.00
crit 17.03 36.03% 177630.08 83459 397938 177720.42 145737 235056 3024226 3024226 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 142.8 63.89% 89499.11 39 198969 89519.55 80102 98133 12779832 12779832 0.00
crit 80.7 36.11% 179192.01 90 397938 179224.90 155569 211374 14460346 14460346 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 87995 27.1% 22.9 15.53sec 1731468 1723749 Periodic 326.7 89097 178167 121238 36.1% 96.2%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.88 0.00 326.72 326.72 1.0045 1.3246 39611744.69 39611744.69 0.00 86914.56 1723748.68
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 208.8 63.91% 89096.57 60 102407 89078.43 83252 93542 18604830 18604830 0.00
crit 117.9 36.09% 178166.94 138 204815 178148.78 163251 186786 21006915 21006915 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 29697 9.1% 108.5 4.14sec 123046 122495 Direct 108.5 90425 180753 123040 36.1%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.46 108.46 0.00 0.00 1.0045 0.0000 13345931.63 19619783.65 31.98 122494.81 122494.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.29 63.89% 90424.66 63161 136190 90440.72 84743 96125 6265677 9211139 31.98
crit 39.17 36.11% 180753.00 126321 272380 180709.85 163527 197649 7080254 10408644 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
arcanocrystal_860 / appendages_880
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / appendages_880
  • harmful:false
  • if_expr:
 
Berserk 3.0 181.93sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / appendages_880
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / appendages_880
  • harmful:false
  • if_expr:
 
Healing Touch 50.5 9.00sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.55 0.00 0.00 0.00 0.8722 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.6 24.60sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.64 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.30sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.33sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.19% 45.5(45.5) 15.1

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 181.9sec 181.9sec 9.79% 14.96% 0.0(0.0) 2.9

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 50.5 0.0 9.0sec 9.0sec 46.34% 46.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.92%
  • bloodtalons_2:27.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 43.3 1.3 10.2sec 9.9sec 6.34% 15.18% 1.3(1.3) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.34%

Trigger Attempt Success

  • trigger_pct:8.74%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Horrific Appendages 5.6 1.0 73.2sec 60.6sec 16.73% 16.82% 100.1(100.1) 5.5

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:16.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Jacin's Ruse 6.6 1.8 64.0sec 48.3sec 24.59% 24.67% 1.8(1.8) 6.4

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.1sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 50.2 1.2 8.9sec 8.7sec 74.17% 74.19% 1.2(1.2) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.17%

Trigger Attempt Success

  • trigger_pct:98.48%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.0 10.6 48.9sec 24.6sec 93.66% 93.39% 202.5(202.5) 7.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.2sec 133.2sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.82% 29.09% 0.0(0.0) 15.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_880
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
arcanocrystal_860 / appendages_880
ferocious_bite Energy 21.4 361.5 16.9 33.8 8311.9
ferocious_bite Combo Points 10.7 49.6 4.6 4.6 60580.6
lunar_inspiration Energy 31.6 783.1 24.8 24.8 13178.1
rake Energy 47.3 1348.8 28.5 28.5 24431.7
rip Energy 22.9 467.0 20.4 20.4 84825.6
rip Combo Points 22.9 114.4 5.0 5.0 346297.4
savage_roar Energy 18.6 481.6 25.8 25.8 0.0
savage_roar Combo Points 18.6 93.2 5.0 5.0 0.0
shred Energy 108.5 3215.7 29.6 29.6 4150.2
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.26 47.26 (18.15%) 1.00 0.00 0.00%
tigers_fury Energy 15.22 912.47 (11.28%) 59.96 0.55 0.06%
ashamanes_frenzy Combo Points 6.11 18.32 (7.04%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.57 31.57 (12.13%) 1.00 0.00 0.00%
shred Combo Points 108.46 108.46 (41.65%) 1.00 0.00 0.00%
energy_regen Energy 2084.73 5041.84 (62.31%) 2.42 70.99 1.39%
clearcasting Energy 43.19 1474.82 (18.23%) 34.15 0.00 0.00%
ashamanes_energy Energy 45.45 662.85 (8.19%) 14.58 18.94 2.78%
primal_fury Combo Points 67.60 54.78 (21.04%) 0.81 12.82 18.97%
Resource RPS-Gain RPS-Loss
Energy 14.71 14.80
Combo Points 0.58 0.57
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 36.24 0.08 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.20 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
clearcasting 44.6 9.9sec
clearcasting_wasted 1.3 122.8sec
primal_fury 67.6 6.6sec

Statistics & Data Analysis

Fight Length
Sample Data arcanocrystal_860 / appendages_880 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data arcanocrystal_860 / appendages_880 Damage Per Second
Count 2499
Mean 324904.83
Minimum 293030.12
Maximum 365148.44
Spread ( max - min ) 72118.31
Range [ ( max - min ) / 2 * 100% ] 11.10%
Standard Deviation 10877.0541
5th Percentile 307398.04
95th Percentile 342743.91
( 95th Percentile - 5th Percentile ) 35345.87
Mean Distribution
Standard Deviation 217.5846
95.00% Confidence Intervall ( 324478.37 - 325331.29 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4305
0.1 Scale Factor Error with Delta=300 1009964
0.05 Scale Factor Error with Delta=300 4039859
0.01 Scale Factor Error with Delta=300 100996482
Priority Target DPS
Sample Data arcanocrystal_860 / appendages_880 Priority Target Damage Per Second
Count 2499
Mean 324904.83
Minimum 293030.12
Maximum 365148.44
Spread ( max - min ) 72118.31
Range [ ( max - min ) / 2 * 100% ] 11.10%
Standard Deviation 10877.0541
5th Percentile 307398.04
95th Percentile 342743.91
( 95th Percentile - 5th Percentile ) 35345.87
Mean Distribution
Standard Deviation 217.5846
95.00% Confidence Intervall ( 324478.37 - 325331.29 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4305
0.1 Scale Factor Error with Delta=300 1009964
0.05 Scale Factor Error with Delta=300 4039859
0.01 Scale Factor Error with Delta=300 100996482
DPS(e)
Sample Data arcanocrystal_860 / appendages_880 Damage Per Second (Effective)
Count 2499
Mean 324904.83
Minimum 293030.12
Maximum 365148.44
Spread ( max - min ) 72118.31
Range [ ( max - min ) / 2 * 100% ] 11.10%
Damage
Sample Data arcanocrystal_860 / appendages_880 Damage
Count 2499
Mean 146098625.16
Minimum 108235500.14
Maximum 183329706.12
Spread ( max - min ) 75094205.98
Range [ ( max - min ) / 2 * 100% ] 25.70%
DTPS
Sample Data arcanocrystal_860 / appendages_880 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data arcanocrystal_860 / appendages_880 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data arcanocrystal_860 / appendages_880 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data arcanocrystal_860 / appendages_880 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data arcanocrystal_860 / appendages_880 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data arcanocrystal_860 / appendages_880 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data arcanocrystal_860 / appendages_880Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data arcanocrystal_860 / appendages_880 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.57 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.57 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.22 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 3.96 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 49.55 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.01 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.88 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 10.63 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 6.75 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.11 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.57 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.68 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.57 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 108.46 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQCAQIQQEMJQOPELOQQQQEJOQQPEIOQQCEJN89QQQELPQQEJOPQQEIOCQQQEJOPQEKOQQPEJMQQELCOPQEJOQQEIOPQQEJOQQEKPCQOQEJQQQQPEJOQQQEKOPCN89EJQEMLQPQQEJOQQPEIOCAQQQEJOQPQEKQOQQQEJQQQPELCOQQQEJOPQQQEIOMEJPOQECJOQPQEKOQQPEJOQQQCQEJN89PQQEIQQQEJOPQEKOCPQQEJMQOEJOPQEKOQPCQEJOQQQEKOPQEDOPQCABQELOQQQEKOQPQQELOQQQELMCOPEKN89QQPEDQOQEKCOPDQQQOEPDO

Sample Sequence Table

time name target resources buffs
Pre flask arcanocrystal_860 / appendages_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food arcanocrystal_860 / appendages_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation arcanocrystal_860 / appendages_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, jacins_ruse, potion_of_the_old_war
0:01.004 lunar_inspiration Fluffy_Pillow 76.5/100: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, jacins_ruse, potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 60.9/100: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, jacins_ruse, potion_of_the_old_war
0:03.015 tigers_fury Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, jacins_ruse, potion_of_the_old_war
0:03.015 berserk Fluffy_Pillow 95.4/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, tigers_fury, jacins_ruse, potion_of_the_old_war
0:03.015 shred Fluffy_Pillow 95.4/150: 64% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, jacins_ruse, potion_of_the_old_war
0:04.019 savage_roar Fluffy_Pillow 104.9/150: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, jacins_ruse, potion_of_the_old_war
0:05.025 shred Fluffy_Pillow 114.3/150: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:06.031 shred Fluffy_Pillow 123.8/150: 83% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:07.037 healing_touch Fluffy_Pillow 118.3/150: 79% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:07.792 ashamanes_frenzy Fluffy_Pillow 129.2/150: 86% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, bloodtalons(2), berserk, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:08.795 rip Fluffy_Pillow 143.6/150: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons, berserk, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:09.800 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:10.805 rake Fluffy_Pillow 144.5/150: 96% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:11.809 lunar_inspiration Fluffy_Pillow 141.4/150: 94% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:12.815 healing_touch Fluffy_Pillow 140.9/150: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:13.570 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, horrific_appendages, jacins_ruse, potion_of_the_old_war
0:14.574 rake Fluffy_Pillow 139.5/150: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse, potion_of_the_old_war
0:15.580 shred Fluffy_Pillow 136.4/150: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
0:16.585 shred Fluffy_Pillow 130.9/150: 87% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
0:17.590 shred Fluffy_Pillow 125.4/150: 84% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
0:18.594 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
0:19.598 healing_touch Fluffy_Pillow 74.5/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
0:20.352 Waiting 0.100 sec 85.3/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, horrific_appendages, potion_of_the_old_war
0:20.452 rip Fluffy_Pillow 86.7/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, horrific_appendages, potion_of_the_old_war
0:21.456 rake Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
0:22.460 shred Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
0:23.465 Waiting 1.100 sec 25.1/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, horrific_appendages
0:24.565 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, horrific_appendages
0:25.570 Waiting 1.065 sec 15.4/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:26.635 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:27.638 healing_touch Fluffy_Pillow 15.2/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:29.412 savage_roar Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2)
0:30.418 rake Fluffy_Pillow 15.2/100: 15% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
0:31.423 shred Fluffy_Pillow 29.7/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, bloodtalons, predatory_swiftness, savage_roar
0:32.427 shred Fluffy_Pillow 44.1/100: 44% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:33.432 tigers_fury Fluffy_Pillow 18.6/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:33.432 healing_touch Fluffy_Pillow 78.6/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.185 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:35.190 shadowmeld Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.190 rake Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.190 auto_attack Fluffy_Pillow 53.9/100: 54% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.193 shred Fluffy_Pillow 83.3/100: 83% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:37.198 shred Fluffy_Pillow 72.8/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury
0:38.203 shred Fluffy_Pillow 87.3/100: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.207 healing_touch Fluffy_Pillow 61.7/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.962 Waiting 1.000 sec 72.6/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:40.962 ferocious_bite Fluffy_Pillow 87.0/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:41.967 lunar_inspiration Fluffy_Pillow 48.1/100: 48% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
0:42.972 Waiting 1.000 sec 29.2/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
0:43.972 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
0:44.976 Waiting 2.624 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:47.600 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:48.604 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:49.512 Waiting 0.800 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:50.312 rip Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
0:53.614 rake Fluffy_Pillow 37.1/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, horrific_appendages
0:54.619 Waiting 1.563 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, horrific_appendages
0:56.182 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, horrific_appendages
0:57.186 shred Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, horrific_appendages
0:58.191 Waiting 0.601 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, horrific_appendages
0:58.792 shred Fluffy_Pillow 29.4/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, horrific_appendages
0:59.796 healing_touch Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, horrific_appendages
1:00.704 savage_roar Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), horrific_appendages
1:02.987 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages
1:03.992 tigers_fury Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
1:03.992 shred Fluffy_Pillow 72.0/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:04.997 shred Fluffy_Pillow 58.1/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:06.001 shred Fluffy_Pillow 84.3/100: 84% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:07.006 healing_touch Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:07.914 Waiting 0.800 sec 80.4/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, horrific_appendages
1:08.714 rip Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, horrific_appendages
1:09.720 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:10.724 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:11.728 shred Fluffy_Pillow 81.1/100: 81% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:12.733 healing_touch Fluffy_Pillow 52.2/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages
1:13.641 Waiting 2.500 sec 62.3/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
1:16.141 savage_roar Fluffy_Pillow 90.0/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:17.146 rake Fluffy_Pillow 61.1/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:18.153 shred Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
1:19.155 shred Fluffy_Pillow 48.4/100: 48% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:20.160 Waiting 0.997 sec 19.5/100: 19% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:21.157 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:22.161 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:23.068 Waiting 1.299 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:24.367 rip Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:25.370 ashamanes_frenzy Fluffy_Pillow 47.2/100: 47% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:26.375 shred Fluffy_Pillow 58.3/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:27.381 Waiting 1.000 sec 29.4/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:28.381 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:29.384 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:30.290 Waiting 2.601 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:32.891 ferocious_bite Fluffy_Pillow 50.5/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:33.896 tigers_fury Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:33.992 rake Fluffy_Pillow 72.7/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:34.998 lunar_inspiration Fluffy_Pillow 63.8/100: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:36.002 shred Fluffy_Pillow 59.9/100: 60% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:37.006 healing_touch Fluffy_Pillow 46.0/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:37.914 Waiting 1.100 sec 56.1/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:39.014 rip Fluffy_Pillow 68.3/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
1:40.019 rake Fluffy_Pillow 79.4/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:41.026 shred Fluffy_Pillow 55.5/100: 56% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:42.031 Waiting 1.300 sec 26.7/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:43.331 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:44.336 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:45.244 Waiting 2.148 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:47.392 savage_roar Fluffy_Pillow 46.0/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
1:49.417 rake Fluffy_Pillow 28.5/100: 28% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
1:50.423 lunar_inspiration Fluffy_Pillow 39.6/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:51.428 Waiting 1.786 sec 20.7/100: 21% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
1:53.214 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
1:54.218 shred Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
1:55.222 healing_touch Fluffy_Pillow 22.7/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:56.130 Waiting 2.200 sec 32.8/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:58.330 rip Fluffy_Pillow 57.2/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:59.335 rake Fluffy_Pillow 68.3/100: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:00.339 shred Fluffy_Pillow 44.4/100: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
2:01.343 shred Fluffy_Pillow 55.5/100: 56% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:02.348 healing_touch Fluffy_Pillow 26.6/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:03.255 savage_roar Fluffy_Pillow 36.7/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
2:04.259 lunar_inspiration Fluffy_Pillow 47.8/100: 48% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
2:05.264 tigers_fury Fluffy_Pillow 28.9/100: 29% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
2:05.264 shred Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:06.267 rake Fluffy_Pillow 75.0/100: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:07.273 shred Fluffy_Pillow 66.2/100: 66% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:08.279 healing_touch Fluffy_Pillow 52.3/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:09.186 rip Fluffy_Pillow 62.4/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
2:10.191 shred Fluffy_Pillow 73.5/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:11.197 shred Fluffy_Pillow 44.6/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:12.203 Waiting 2.233 sec 15.8/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:14.436 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:15.441 Waiting 1.207 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:16.648 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
2:17.652 lunar_inspiration Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:18.656 healing_touch Fluffy_Pillow 17.2/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:19.564 Waiting 2.600 sec 27.3/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
2:22.164 rip Fluffy_Pillow 56.1/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
2:23.168 rake Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:24.172 shred Fluffy_Pillow 43.3/100: 43% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:25.176 Waiting 1.155 sec 14.4/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:26.331 shred Fluffy_Pillow 27.2/100: 27% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:27.334 Waiting 0.200 sec 38.3/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:27.534 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:28.539 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:29.446 Waiting 0.297 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
2:29.743 savage_roar Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
2:30.748 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
2:31.755 Waiting 1.649 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:33.404 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:34.410 Waiting 1.203 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:35.613 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:35.613 shadowmeld Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:35.613 rake Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:35.613 auto_attack Fluffy_Pillow 50.0/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:36.618 healing_touch Fluffy_Pillow 76.1/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:37.526 Waiting 0.100 sec 86.2/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:37.626 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:38.630 shred Fluffy_Pillow 96.1/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:39.634 healing_touch Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:40.542 ashamanes_frenzy Fluffy_Pillow 77.3/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar, tigers_fury
2:41.547 Waiting 0.100 sec 88.4/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, tigers_fury
2:41.647 ferocious_bite Fluffy_Pillow 89.5/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, tigers_fury
2:42.653 shred Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
2:43.657 Waiting 1.190 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:44.847 lunar_inspiration Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:45.851 Waiting 1.505 sec 16.1/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:47.356 shred Fluffy_Pillow 32.7/100: 33% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
2:48.361 shred Fluffy_Pillow 43.9/100: 44% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:49.365 healing_touch Fluffy_Pillow 15.0/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:50.272 Waiting 0.500 sec 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
2:50.772 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
2:52.032 rake Fluffy_Pillow 14.5/100: 15% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
2:53.038 Waiting 1.300 sec 25.7/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:54.338 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:55.341 Waiting 2.649 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:57.990 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:58.994 Waiting 1.208 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, horrific_appendages, jacins_ruse
3:00.202 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, horrific_appendages, jacins_ruse
3:01.207 healing_touch Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, horrific_appendages, jacins_ruse
3:02.115 savage_roar Fluffy_Pillow 46.2/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
3:04.902 rake Fluffy_Pillow 37.0/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
3:05.906 tigers_fury Fluffy_Pillow 13.2/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:05.906 berserk Fluffy_Pillow 73.2/100: 73% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:05.906 shred Fluffy_Pillow 73.2/150: 49% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:06.913 shred Fluffy_Pillow 79.3/150: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:07.917 shred Fluffy_Pillow 85.4/150: 57% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:08.920 healing_touch Fluffy_Pillow 91.5/150: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:09.828 rip Fluffy_Pillow 101.6/150: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, jacins_ruse
3:10.831 rake Fluffy_Pillow 97.7/150: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:11.836 shred Fluffy_Pillow 108.8/150: 73% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:12.839 lunar_inspiration Fluffy_Pillow 99.9/150: 67% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:13.841 shred Fluffy_Pillow 96.0/150: 64% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:14.845 healing_touch Fluffy_Pillow 87.1/150: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:15.753 savage_roar Fluffy_Pillow 97.2/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar
3:16.757 shred Fluffy_Pillow 108.3/150: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar
3:17.762 rake Fluffy_Pillow 99.4/150: 66% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:18.767 shred Fluffy_Pillow 93.1/150: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar
3:19.773 shred Fluffy_Pillow 84.2/150: 56% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:20.777 shred Fluffy_Pillow 75.3/150: 50% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar
3:21.782 healing_touch Fluffy_Pillow 66.4/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
3:22.690 rip Fluffy_Pillow 76.5/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:23.695 shred Fluffy_Pillow 87.6/100: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:24.699 shred Fluffy_Pillow 58.8/100: 59% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:25.703 Waiting 1.000 sec 29.9/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:26.703 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:27.709 Waiting 1.666 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:29.375 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:30.379 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:31.287 Waiting 2.597 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:33.884 ferocious_bite Fluffy_Pillow 50.5/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:35.656 tigers_fury Fluffy_Pillow 20.1/100: 20% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:35.906 rake Fluffy_Pillow 82.8/100: 83% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:36.912 shred Fluffy_Pillow 74.0/100: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:37.918 shred Fluffy_Pillow 60.1/100: 60% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:38.923 shred Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
3:39.928 healing_touch Fluffy_Pillow 57.4/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
3:40.836 Waiting 2.000 sec 67.4/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
3:42.836 rip Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
3:43.840 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
3:44.844 lunar_inspiration Fluffy_Pillow 76.1/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:45.849 shred Fluffy_Pillow 57.2/100: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:46.855 Waiting 1.100 sec 28.4/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:47.955 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
3:48.957 Waiting 2.604 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
3:51.561 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
3:52.566 healing_touch Fluffy_Pillow 51.6/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
3:53.473 savage_roar Fluffy_Pillow 61.7/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
3:54.733 rake Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:55.736 ashamanes_frenzy Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:56.741 healing_touch Fluffy_Pillow 22.9/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:57.648 rip Fluffy_Pillow 32.9/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:58.652 lunar_inspiration Fluffy_Pillow 44.0/100: 44% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:00.677 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:01.680 Waiting 2.524 sec 12.5/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:04.204 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:05.209 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:06.116 tigers_fury Fluffy_Pillow 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:06.116 Waiting 0.400 sec 81.7/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:06.516 rip Fluffy_Pillow 86.1/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:07.521 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:08.525 shred Fluffy_Pillow 91.1/100: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:09.530 lunar_inspiration Fluffy_Pillow 77.2/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
4:10.534 shred Fluffy_Pillow 58.4/100: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:11.539 healing_touch Fluffy_Pillow 29.5/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:12.445 Waiting 4.500 sec 39.5/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, horrific_appendages
4:16.945 savage_roar Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
4:17.950 rake Fluffy_Pillow 60.5/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages
4:18.955 Waiting 0.400 sec 36.6/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
4:19.355 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
4:20.361 shred Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages
4:21.365 Waiting 1.453 sec 23.3/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
4:22.818 lunar_inspiration Fluffy_Pillow 39.4/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
4:23.822 healing_touch Fluffy_Pillow 20.5/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages
4:24.730 Waiting 1.200 sec 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
4:25.930 rip Fluffy_Pillow 43.8/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages
4:26.934 rake Fluffy_Pillow 55.0/100: 55% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
4:27.939 shred Fluffy_Pillow 66.1/100: 66% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages
4:28.943 Waiting 0.300 sec 37.2/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
4:29.243 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
4:30.250 Waiting 2.602 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
4:32.852 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
4:33.855 Waiting 2.109 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
4:35.964 tigers_fury Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
4:36.116 shred Fluffy_Pillow 96.6/100: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
4:37.121 healing_touch Fluffy_Pillow 82.8/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:38.029 rip Fluffy_Pillow 92.8/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
4:39.034 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:39.034 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:39.034 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:40.038 lunar_inspiration Fluffy_Pillow 91.1/100: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:41.042 shred Fluffy_Pillow 72.2/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:42.047 shred Fluffy_Pillow 43.4/100: 43% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury, jacins_ruse
4:43.050 healing_touch Fluffy_Pillow 14.5/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, jacins_ruse
4:45.492 savage_roar Fluffy_Pillow 41.5/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), jacins_ruse
4:46.496 shred Fluffy_Pillow 52.6/100: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
4:47.501 shred Fluffy_Pillow 23.8/100: 24% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:48.506 Waiting 0.500 sec 34.9/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:49.006 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:50.011 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:50.919 Waiting 0.806 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:51.725 rip Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:54.517 rake Fluffy_Pillow 31.4/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:55.520 lunar_inspiration Fluffy_Pillow 42.6/100: 43% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:56.526 Waiting 1.518 sec 23.7/100: 24% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:58.044 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:59.047 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:59.953 Waiting 3.203 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:03.156 savage_roar Fluffy_Pillow 57.1/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:04.924 rake Fluffy_Pillow 36.7/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:05.929 tigers_fury Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:06.116 lunar_inspiration Fluffy_Pillow 74.9/100: 75% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:07.120 shred Fluffy_Pillow 71.0/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:08.124 shred Fluffy_Pillow 57.1/100: 57% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:09.131 healing_touch Fluffy_Pillow 43.3/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:10.039 Waiting 2.600 sec 53.3/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:12.639 rip Fluffy_Pillow 82.1/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:13.643 ashamanes_frenzy Fluffy_Pillow 63.2/100: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:14.646 shred Fluffy_Pillow 74.3/100: 74% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:15.649 rake Fluffy_Pillow 45.4/100: 45% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:16.655 healing_touch Fluffy_Pillow 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:17.563 Waiting 5.200 sec 31.6/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:22.763 rip Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:23.768 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:24.773 lunar_inspiration Fluffy_Pillow 76.1/100: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:25.778 shred Fluffy_Pillow 57.3/100: 57% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:26.781 healing_touch Fluffy_Pillow 28.4/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:27.690 Waiting 4.600 sec 38.4/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:32.290 savage_roar Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:33.294 rake Fluffy_Pillow 60.5/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:34.299 shred Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:35.303 lunar_inspiration Fluffy_Pillow 47.7/100: 48% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:36.308 tigers_fury Fluffy_Pillow 28.9/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:36.308 shred Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:37.310 healing_touch Fluffy_Pillow 75.0/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:38.217 Waiting 0.100 sec 85.0/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
5:38.317 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
5:39.321 rake Fluffy_Pillow 96.1/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:40.325 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:41.329 shred Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:42.334 shred Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:43.338 healing_touch Fluffy_Pillow 13.4/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:44.247 Waiting 5.941 sec 23.4/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
5:50.188 savage_roar Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:51.193 rake Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:52.197 lunar_inspiration Fluffy_Pillow 36.5/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:53.200 shred Fluffy_Pillow 17.6/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:54.205 healing_touch Fluffy_Pillow 28.7/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:55.109 Waiting 1.200 sec 38.7/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:56.309 ferocious_bite Fluffy_Pillow 52.0/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:59.361 rake Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:00.365 Waiting 2.282 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:02.647 lunar_inspiration Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:03.650 Waiting 2.006 sec 18.3/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:05.656 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:06.659 tigers_fury Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:06.659 berserk Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:06.659 potion Fluffy_Pillow 71.6/150: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
6:06.659 shred Fluffy_Pillow 71.6/150: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:07.663 healing_touch Fluffy_Pillow 77.7/150: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:08.571 ferocious_bite Fluffy_Pillow 87.8/150: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:09.576 rake Fluffy_Pillow 88.9/150: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:10.581 shred Fluffy_Pillow 115.0/150: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:11.585 shred Fluffy_Pillow 106.1/150: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:12.592 shred Fluffy_Pillow 97.3/150: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:13.596 healing_touch Fluffy_Pillow 88.4/150: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:14.504 savage_roar Fluffy_Pillow 98.5/150: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:15.510 rake Fluffy_Pillow 109.6/150: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:16.515 shred Fluffy_Pillow 103.2/150: 69% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:17.520 lunar_inspiration Fluffy_Pillow 94.4/150: 63% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:18.524 shred Fluffy_Pillow 90.5/150: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:19.528 shred Fluffy_Pillow 81.6/150: 54% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:20.533 healing_touch Fluffy_Pillow 72.7/150: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:21.441 ferocious_bite Fluffy_Pillow 82.8/150: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, horrific_appendages, potion_of_the_old_war
6:22.444 rake Fluffy_Pillow 68.9/100: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:23.448 shred Fluffy_Pillow 45.0/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:24.450 Waiting 2.203 sec 16.1/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:26.653 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:27.656 Waiting 2.609 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:30.265 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:31.272 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:32.181 Waiting 2.596 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
6:34.777 ferocious_bite Fluffy_Pillow 50.5/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:35.781 ashamanes_frenzy Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:36.785 tigers_fury Fluffy_Pillow 22.7/100: 23% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:36.785 rake Fluffy_Pillow 82.7/100: 83% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:37.790 lunar_inspiration Fluffy_Pillow 73.8/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:38.795 healing_touch Fluffy_Pillow 70.0/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:39.702 Waiting 0.100 sec 80.0/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:39.802 savage_roar Fluffy_Pillow 96.1/100: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
6:40.807 shadowmeld Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
6:40.807 rake Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
6:40.807 auto_attack Fluffy_Pillow 32.2/100: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
6:41.811 shred Fluffy_Pillow 43.3/100: 43% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
6:42.818 Waiting 2.348 sec 14.5/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
6:45.166 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:46.171 Waiting 1.707 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:47.878 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:48.881 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:49.788 Waiting 2.899 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:52.687 ferocious_bite Fluffy_Pillow 53.8/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
6:53.690 Waiting 0.100 sec 39.9/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:53.790 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:57.094 rake Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:58.100 Waiting 2.418 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:00.518 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:01.523 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:02.430 Waiting 1.700 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:04.130 savage_roar Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:06.668 tigers_fury Fluffy_Pillow 28.6/100: 29% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:06.785 rake Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:07.790 lunar_inspiration Fluffy_Pillow 81.0/100: 81% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:08.795 ferocious_bite Fluffy_Pillow 77.1/100: 77% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:09.800 shred Fluffy_Pillow 53.3/100: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
7:10.804 Waiting 1.500 sec 24.4/100: 24% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
7:12.304 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
7:13.311 Waiting 2.559 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
7:15.870 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:16.875 Waiting 1.208 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:19.102 rake Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:20.106 healing_touch Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:21.012 Waiting 0.432 sec 22.4/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar, horrific_appendages
7:21.444 lunar_inspiration Fluffy_Pillow 27.2/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages
7:22.449 Waiting 2.400 sec 38.3/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
7:24.849 ferocious_bite Fluffy_Pillow 64.9/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
7:26.876 rake Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
7:27.880 Waiting 2.240 sec 13.5/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 36.08% 36.08% 7027
Haste 10.73% 10.73% 3488
Damage / Heal Versatility 7.65% 7.65% 3058
Attack Power 21649 19943 0
Mastery 62.26% 60.12% 7721
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 848.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Trinket2 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="arcanocrystal_860 / appendages_880"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=unstable_arcanocrystal,id=141482
trinket2=spontaneous_appendages,id=139325,bonus_id=1806
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=847.50
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=7027
# gear_haste_rating=2325
# gear_mastery_rating=7721
# gear_versatility_rating=3058
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

arcanocrystal_860 / call_880 : 322100 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
322100.2 322100.2 413.2 / 0.128% 40754.2 / 12.7% 21387.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.0 15.0 Energy 30.36% 43.6 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcanocrystal_860 / call_880 322100
Ashamane's Frenzy 15387 4.8% 6.1 78.42sec 1130983 1126025 Direct 91.6 10203 20412 14060 37.8%  
Periodic 30.3 135051 269751 186188 38.0% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.12 91.56 121.82 30.26 1.0045 0.6471 6921672.82 7526853.35 8.04 81449.65 1126024.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.96 62.22% 10202.88 7530 13120 10204.50 9249 11449 581211 854435 31.98
crit 34.59 37.78% 20412.00 15060 26241 20418.55 17873 22950 706148 1038104 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.8 62.03% 135050.54 83022 180827 135083.78 118576 152896 2535263 2535263 0.00
crit 11.5 37.97% 269751.20 166044 361654 269775.36 233025 314811 3099051 3099051 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 38963 12.1% 18.6 22.83sec 940357 0 Periodic 148.8 85502 171040 117808 37.8% 42.7%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.64 0.00 148.80 148.80 0.0000 1.2902 17528876.32 17528876.32 0.00 91303.84 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.6 62.24% 85502.14 59 109531 85432.65 74476 93547 7917937 7917937 0.00
crit 56.2 37.76% 171039.58 117 219063 170842.29 139836 186685 9610939 9610939 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 29854 9.3% 523.3 0.86sec 25665 29918 Direct 523.3 18612 37235 25664 37.9%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 523.26 523.26 0.00 0.00 0.8578 0.0000 13429196.01 19742190.18 31.98 29918.05 29918.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 325.10 62.13% 18612.26 14488 20826 18611.97 18273 18888 6050943 8895459 31.98
crit 198.15 37.87% 37234.97 28976 41653 37235.20 36247 38002 7378253 10846731 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 7412 2.3% 11.4 41.08sec 292653 291340 Direct 11.4 200302 445149 292631 37.7%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.37 11.37 0.00 0.00 1.0045 0.0000 3327391.59 4891580.82 31.98 291339.78 291339.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.08 62.29% 200302.17 15461 256019 200030.03 96228 247671 1418555 2085410 31.98
crit 4.29 37.71% 445149.40 34260 565803 441226.24 0 565803 1908837 2806171 31.76
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 23806 7.4% 31.6 14.34sec 338706 337192 Direct 31.6 33695 67304 46431 37.9%  
Periodic 257.8 26007 51986 35838 37.8% 96.9%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.62 31.62 257.85 257.85 1.0045 1.6913 10708871.94 10708871.94 0.00 22888.95 337191.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.63 62.10% 33695.27 26218 37689 33690.65 31585 35722 661603 661603 0.00
crit 11.98 37.90% 67303.71 52436 75377 67298.07 61176 74148 806466 806466 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 160.3 62.16% 26006.70 14 29314 26007.38 25194 26616 4168124 4168124 0.00
crit 97.6 37.84% 51986.31 29 58627 51984.35 49492 53679 5072678 5072678 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2293 0.7% 24.8 18.09sec 41553 0 Periodic 73.3 14062 0 14062 0.0% 8.1%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.82 0.00 73.34 73.34 0.0000 0.4970 1031331.69 1516155.27 31.98 28295.20 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.3 100.00% 14062.10 27 15789 14065.64 13273 14873 1031332 1516155 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 12075 3.7% 24.4 16.88sec 220028 0 Direct 24.4 159798 319768 220044 37.7%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.38 24.38 0.00 0.00 0.0000 0.0000 5365098.87 7887203.54 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.20 62.35% 159797.68 124406 178834 159785.81 145178 171058 2429392 3571436 31.98
crit 9.18 37.65% 319768.19 248812 357668 319519.37 0 349892 2935707 4315767 31.96
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 73402 22.8% 47.5 9.49sec 694832 691723 Direct 47.5 87619 175665 120921 37.8%  
Periodic 223.4 88558 177048 122062 37.9% 95.1%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.52 47.52 223.44 223.44 1.0045 1.9142 33019403.13 33019403.13 0.00 69447.72 691723.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.55 62.19% 87618.56 40711 212810 87626.55 72942 99964 2589205 2589205 0.00
crit 17.97 37.81% 175664.58 81423 425621 175698.97 146659 229190 3156634 3156634 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 138.8 62.14% 88557.86 70 212810 88589.03 79345 97850 12295090 12295090 0.00
crit 84.6 37.86% 177048.16 87 425621 177090.00 152068 201691 14978474 14978474 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 88199 27.4% 23.1 15.26sec 1717244 1709572 Periodic 327.5 87935 175913 121209 37.8% 96.5%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.12 0.00 327.52 327.52 1.0045 1.3262 39697965.02 39697965.02 0.00 86758.99 1709571.72
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 203.7 62.18% 87934.95 59 109531 87933.70 80238 91620 17908261 17908261 0.00
crit 123.9 37.82% 175913.33 130 219063 175896.03 160113 184266 21789704 21789704 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 30710 9.5% 110.6 4.06sec 124767 124209 Direct 110.6 90616 181094 124767 37.7%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.62 110.62 0.00 0.00 1.0045 0.0000 13802098.33 20290391.92 31.98 124208.95 124208.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.87 62.25% 90615.70 63161 136190 90630.21 85697 98188 6240503 9174130 31.98
crit 41.76 37.75% 181093.62 126321 272380 181019.28 162864 198094 7561595 11116261 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
arcanocrystal_860 / call_880
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / call_880
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.00sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Cleansed Drake's Breath 4.2 78.87sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / call_880
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / call_880
  • harmful:false
  • if_expr:
 
Healing Touch 51.8 8.78sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 51.78 0.00 0.00 0.00 0.8538 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.8 24.42sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.77 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 132.92sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.34sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.10% 10.18% 45.4(45.4) 15.1

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 14.71% 0.0(0.0) 2.9

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.26% 0.0(0.0) 1.0

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 51.7 0.0 8.8sec 8.8sec 46.74% 46.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.80%
  • bloodtalons_2:27.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Cleansed Ancient's Blessing 3.9 0.3 88.7sec 79.7sec 8.92% 9.01% 0.3(0.3) 3.8

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_ancients_blessing_1:8.92%

Trigger Attempt Success

  • trigger_pct:98.55%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 4.0 0.3 87.4sec 79.0sec 9.08% 9.18% 0.3(0.3) 3.9

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_sisters_blessing_1:9.08%

Trigger Attempt Success

  • trigger_pct:98.80%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 4.0 0.3 87.5sec 79.1sec 9.09% 9.18% 0.3(0.3) 3.9

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_wisps_blessing_1:9.09%

Trigger Attempt Success

  • trigger_pct:98.75%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Clearcasting 44.4 1.5 10.0sec 9.6sec 6.70% 15.35% 1.5(1.5) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.70%

Trigger Attempt Success

  • trigger_pct:8.78%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.8 64.1sec 48.6sec 24.57% 24.65% 1.8(1.8) 6.4

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.0sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 51.5 1.1 8.7sec 8.5sec 74.06% 74.07% 1.1(1.1) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.06%

Trigger Attempt Success

  • trigger_pct:98.67%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 7.5 11.2 51.4sec 24.4sec 94.19% 93.91% 202.8(202.8) 6.5

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:94.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.2sec 133.2sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.80% 28.99% 0.0(0.0) 14.9

Buff details

  • buff initial source:arcanocrystal_860 / call_880
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
arcanocrystal_860 / call_880
ferocious_bite Energy 22.7 390.1 17.2 34.3 8529.0
ferocious_bite Combo Points 11.4 53.4 4.7 4.7 62272.4
lunar_inspiration Energy 31.6 785.7 24.8 24.8 13630.2
rake Energy 47.5 1355.9 28.5 28.5 24353.3
rip Energy 23.1 466.1 20.2 20.2 85164.4
rip Combo Points 23.1 115.6 5.0 5.0 343439.1
savage_roar Energy 18.8 479.8 25.6 25.6 0.0
savage_roar Combo Points 18.8 93.9 5.0 5.0 0.0
shred Energy 110.6 3294.0 29.8 29.8 4190.0
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.52 47.52 (17.86%) 1.00 0.00 0.00%
tigers_fury Energy 15.20 911.55 (11.05%) 59.96 0.53 0.06%
ashamanes_frenzy Combo Points 6.12 18.36 (6.90%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.62 31.62 (11.88%) 1.00 0.00 0.00%
shred Combo Points 110.62 110.62 (41.57%) 1.00 0.00 0.00%
energy_regen Energy 2022.50 5162.93 (62.61%) 2.55 80.02 1.53%
clearcasting Energy 44.33 1511.02 (18.32%) 34.09 0.00 0.00%
ashamanes_energy Energy 45.41 660.75 (8.01%) 14.55 20.33 2.99%
primal_fury Combo Points 71.71 57.99 (21.79%) 0.81 13.72 19.13%
Resource RPS-Gain RPS-Loss
Energy 14.97 15.05
Combo Points 0.59 0.58
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 37.45 0.02 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.25 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.9%

Procs

Count Interval
clearcasting 45.9 9.6sec
clearcasting_wasted 1.5 121.0sec
primal_fury 71.7 6.3sec

Statistics & Data Analysis

Fight Length
Sample Data arcanocrystal_860 / call_880 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data arcanocrystal_860 / call_880 Damage Per Second
Count 2499
Mean 322100.19
Minimum 285581.99
Maximum 357078.43
Spread ( max - min ) 71496.44
Range [ ( max - min ) / 2 * 100% ] 11.10%
Standard Deviation 10540.0462
5th Percentile 304978.24
95th Percentile 339610.63
( 95th Percentile - 5th Percentile ) 34632.39
Mean Distribution
Standard Deviation 210.8431
95.00% Confidence Intervall ( 321686.95 - 322513.44 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4113
0.1 Scale Factor Error with Delta=300 948350
0.05 Scale Factor Error with Delta=300 3793400
0.01 Scale Factor Error with Delta=300 94835011
Priority Target DPS
Sample Data arcanocrystal_860 / call_880 Priority Target Damage Per Second
Count 2499
Mean 322100.19
Minimum 285581.99
Maximum 357078.43
Spread ( max - min ) 71496.44
Range [ ( max - min ) / 2 * 100% ] 11.10%
Standard Deviation 10540.0462
5th Percentile 304978.24
95th Percentile 339610.63
( 95th Percentile - 5th Percentile ) 34632.39
Mean Distribution
Standard Deviation 210.8431
95.00% Confidence Intervall ( 321686.95 - 322513.44 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4113
0.1 Scale Factor Error with Delta=300 948350
0.05 Scale Factor Error with Delta=300 3793400
0.01 Scale Factor Error with Delta=300 94835011
DPS(e)
Sample Data arcanocrystal_860 / call_880 Damage Per Second (Effective)
Count 2499
Mean 322100.19
Minimum 285581.99
Maximum 357078.43
Spread ( max - min ) 71496.44
Range [ ( max - min ) / 2 * 100% ] 11.10%
Damage
Sample Data arcanocrystal_860 / call_880 Damage
Count 2499
Mean 144831905.72
Minimum 107322175.91
Maximum 185517890.02
Spread ( max - min ) 78195714.11
Range [ ( max - min ) / 2 * 100% ] 27.00%
DTPS
Sample Data arcanocrystal_860 / call_880 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data arcanocrystal_860 / call_880 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data arcanocrystal_860 / call_880 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data arcanocrystal_860 / call_880 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data arcanocrystal_860 / call_880 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data arcanocrystal_860 / call_880 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data arcanocrystal_860 / call_880Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data arcanocrystal_860 / call_880 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.57 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.57 auto_attack
0.00 skull_bash
A 2.95 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.20 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 3.74 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 50.78 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 7.53 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 23.12 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 11.24 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 7.63 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.12 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.57 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.95 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.62 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 110.62 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQCAQIQEMJQQOELPOQQEJQQQQEKOPOCQEJN89QQQEKPQQQEJQOQPQELOCQQQEJOPQEIOPQQEJMQQECJOPQQEKOQQPEJOQQQEJCOPQQEIOQPEOQJQQQPEJCOQQQQEIN89MQEJPQOQEOCAIPQQQEJOQQQQELOPQQEJOPQCQQEIOQQEJOPQEJOQQEIMOCEJPQQELOQQPEJOQQPEICOQQQEJOPQQEJOQPQECIN89QQQEJQPOEKMOQEJOPQCQEJOQQQPEKOQQQEDOPCABQQEKOQDQPQELOQQQELOPQQEKCMOELQQPQEKOPDQQOCQQELN89PQQEKQOQPE

Sample Sequence Table

time name target resources buffs
Pre flask arcanocrystal_860 / call_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food arcanocrystal_860 / call_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation arcanocrystal_860 / call_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 76.7/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, cleansed_wisps_blessing, potion_of_the_old_war
0:02.009 shred Fluffy_Pillow 61.3/100: 61% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, cleansed_wisps_blessing, potion_of_the_old_war
0:03.014 tigers_fury Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, cleansed_wisps_blessing, potion_of_the_old_war
0:03.014 berserk Fluffy_Pillow 96.0/100: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:03.014 shred Fluffy_Pillow 96.0/150: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:04.018 savage_roar Fluffy_Pillow 105.7/150: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, ashamanes_energy, berserk, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:05.022 shred Fluffy_Pillow 135.3/150: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:06.026 healing_touch Fluffy_Pillow 145.0/150: 97% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:06.782 ashamanes_frenzy Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:07.787 rip Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:08.790 shred Fluffy_Pillow 149.6/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:09.794 shred Fluffy_Pillow 144.3/150: 96% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:10.798 rake Fluffy_Pillow 139.0/150: 93% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:11.802 healing_touch Fluffy_Pillow 136.1/150: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:12.555 ferocious_bite Fluffy_Pillow 147.1/150: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
0:13.561 lunar_inspiration Fluffy_Pillow 136.8/150: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:14.566 rake Fluffy_Pillow 136.5/150: 91% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:15.570 shred Fluffy_Pillow 133.7/150: 89% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:16.575 shred Fluffy_Pillow 128.3/150: 86% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:17.579 healing_touch Fluffy_Pillow 123.0/150: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:18.333 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, jacins_ruse, potion_of_the_old_war
0:19.338 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:20.341 shred Fluffy_Pillow 74.6/100: 75% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:21.344 shred Fluffy_Pillow 49.3/100: 49% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:22.349 Waiting 1.100 sec 24.0/100: 24% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:23.449 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:24.454 healing_touch Fluffy_Pillow 14.7/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
0:25.208 Waiting 1.000 sec 25.7/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, cleansed_ancients_blessing, jacins_ruse
0:26.208 savage_roar Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing, jacins_ruse
0:27.212 rake Fluffy_Pillow 55.0/100: 55% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
0:28.217 lunar_inspiration Fluffy_Pillow 34.7/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
0:29.222 Waiting 1.487 sec 19.3/100: 19% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
0:30.709 rake Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
0:31.714 Waiting 1.091 sec 20.7/100: 21% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
0:32.805 tigers_fury Fluffy_Pillow 36.7/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
0:33.014 shred Fluffy_Pillow 99.7/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
0:34.020 healing_touch Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.774 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:35.778 shadowmeld Fluffy_Pillow 99.7/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.778 rake Fluffy_Pillow 99.7/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.778 auto_attack Fluffy_Pillow 64.7/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.782 shred Fluffy_Pillow 94.3/100: 94% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:37.787 shred Fluffy_Pillow 69.0/100: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:38.795 shred Fluffy_Pillow 43.7/100: 44% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury
0:39.800 healing_touch Fluffy_Pillow 58.4/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:40.555 Waiting 1.000 sec 69.4/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:41.555 savage_roar Fluffy_Pillow 82.0/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:42.560 lunar_inspiration Fluffy_Pillow 93.3/100: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:43.564 shred Fluffy_Pillow 74.6/100: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:44.569 shred Fluffy_Pillow 85.9/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:45.575 shred Fluffy_Pillow 97.2/100: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:46.579 healing_touch Fluffy_Pillow 68.4/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:47.474 rip Fluffy_Pillow 78.5/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
0:48.479 shred Fluffy_Pillow 59.8/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:49.481 rake Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:50.485 shred Fluffy_Pillow 42.3/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:51.490 Waiting 1.513 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:53.003 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:54.008 Waiting 1.165 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:55.173 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
0:56.178 healing_touch Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:57.072 Waiting 3.000 sec 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:00.072 ferocious_bite Fluffy_Pillow 80.0/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:01.077 rake Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:02.081 Waiting 0.759 sec 17.6/100: 18% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:02.840 tigers_fury Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:03.014 shred Fluffy_Pillow 88.1/100: 88% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:04.019 shred Fluffy_Pillow 74.4/100: 74% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:05.024 shred Fluffy_Pillow 60.7/100: 61% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:06.028 healing_touch Fluffy_Pillow 46.9/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:06.924 Waiting 1.500 sec 57.0/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
1:08.424 rip Fluffy_Pillow 73.8/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
1:09.429 rake Fluffy_Pillow 55.1/100: 55% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:10.434 lunar_inspiration Fluffy_Pillow 31.4/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:11.439 Waiting 2.493 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:13.932 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, jacins_ruse
1:14.937 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, jacins_ruse
1:17.623 savage_roar Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
1:19.655 rake Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
1:20.658 Waiting 0.200 sec 36.3/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:20.858 lunar_inspiration Fluffy_Pillow 38.5/100: 39% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:21.861 Waiting 1.862 sec 19.8/100: 20% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:23.723 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:24.729 Waiting 1.155 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:25.884 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:26.889 healing_touch Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:27.781 rip Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing, jacins_ruse
1:28.786 ashamanes_frenzy Fluffy_Pillow 57.6/100: 58% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:29.791 shred Fluffy_Pillow 68.9/100: 69% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:30.796 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:31.800 healing_touch Fluffy_Pillow 11.5/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:32.696 Waiting 0.309 sec 21.5/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing, jacins_ruse
1:33.005 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing, jacins_ruse
1:33.014 rip Fluffy_Pillow 85.1/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
1:34.019 rake Fluffy_Pillow 81.4/100: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
1:35.022 lunar_inspiration Fluffy_Pillow 72.6/100: 73% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:36.025 shred Fluffy_Pillow 68.9/100: 69% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:37.030 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:38.034 healing_touch Fluffy_Pillow 11.5/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:38.928 Waiting 0.809 sec 21.5/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:39.737 savage_roar Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
1:40.739 rake Fluffy_Pillow 41.9/100: 42% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
1:41.745 Waiting 2.007 sec 18.2/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:43.752 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:44.757 Waiting 2.556 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:47.313 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:48.318 Waiting 1.656 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:49.974 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:50.979 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:51.871 Waiting 0.773 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:52.644 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:55.948 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:56.953 shred Fluffy_Pillow 14.0/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
1:57.957 Waiting 1.400 sec 25.3/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:59.357 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:00.361 Waiting 2.030 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:02.391 shred Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
2:03.396 healing_touch Fluffy_Pillow 46.4/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:04.291 rip Fluffy_Pillow 56.5/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:05.295 tigers_fury Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:05.295 rake Fluffy_Pillow 97.7/100: 98% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:06.301 lunar_inspiration Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury
2:07.305 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
2:08.310 shred Fluffy_Pillow 86.3/100: 86% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
2:09.313 healing_touch Fluffy_Pillow 57.6/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
2:10.207 savage_roar Fluffy_Pillow 67.6/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
2:11.212 rake Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
2:12.216 Waiting 2.275 sec 15.2/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:14.491 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:15.495 Waiting 1.656 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:17.151 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:18.156 Waiting 2.566 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:20.722 healing_touch Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:21.618 rake Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:22.622 shred Fluffy_Pillow 27.1/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons, savage_roar, jacins_ruse
2:23.625 Waiting 1.600 sec 38.3/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points savage_roar, jacins_ruse
2:25.225 rip Fluffy_Pillow 56.3/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points savage_roar, jacins_ruse
2:26.229 shred Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
2:27.232 shred Fluffy_Pillow 48.9/100: 49% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:28.239 Waiting 1.830 sec 20.2/100: 20% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
2:30.069 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
2:31.072 lunar_inspiration Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing
2:32.077 healing_touch Fluffy_Pillow 23.3/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
2:32.972 rip Fluffy_Pillow 33.3/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
2:34.234 Waiting 0.666 sec 17.5/100: 18% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, cleansed_ancients_blessing
2:35.158 tigers_fury Fluffy_Pillow 27.9/100: 28% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, cleansed_ancients_blessing
2:35.295 rake Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, tigers_fury, cleansed_ancients_blessing
2:36.300 shred Fluffy_Pillow 80.7/100: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, cleansed_ancients_blessing
2:37.305 shred Fluffy_Pillow 67.0/100: 67% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury
2:38.309 shred Fluffy_Pillow 93.3/100: 93% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
2:39.314 shred Fluffy_Pillow 64.6/100: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
2:40.320 healing_touch Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, tigers_fury
2:41.214 savage_roar Fluffy_Pillow 45.9/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), tigers_fury
2:42.217 shadowmeld Fluffy_Pillow 57.2/100: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
2:42.217 rake Fluffy_Pillow 57.2/100: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
2:42.217 auto_attack Fluffy_Pillow 22.2/100: 22% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:43.219 Waiting 0.400 sec 33.5/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:43.619 ashamanes_frenzy Fluffy_Pillow 37.9/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:44.790 shred Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:45.795 healing_touch Fluffy_Pillow 22.4/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:46.690 Waiting 5.100 sec 32.4/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:51.790 rip Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:52.794 lunar_inspiration Fluffy_Pillow 71.0/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:53.800 shred Fluffy_Pillow 52.3/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:54.806 Waiting 0.522 sec 23.6/100: 24% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:55.838 rake Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:56.842 Waiting 2.602 sec 11.5/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:59.444 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:00.449 Waiting 1.856 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:02.305 healing_touch Fluffy_Pillow 32.9/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:03.199 rake Fluffy_Pillow 42.9/100: 43% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
3:04.205 Waiting 0.915 sec 19.2/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
3:05.120 tigers_fury Fluffy_Pillow 29.5/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
3:05.295 berserk Fluffy_Pillow 91.5/100: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, tigers_fury
3:05.295 savage_roar Fluffy_Pillow 91.5/150: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, berserk, tigers_fury
3:06.298 lunar_inspiration Fluffy_Pillow 97.7/150: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:07.303 shred Fluffy_Pillow 109.0/150: 73% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:08.307 shred Fluffy_Pillow 115.3/150: 77% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:09.312 shred Fluffy_Pillow 106.6/150: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:10.319 healing_touch Fluffy_Pillow 97.9/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:11.215 rip Fluffy_Pillow 108.0/150: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury
3:12.220 rake Fluffy_Pillow 105.5/150: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
3:13.225 shred Fluffy_Pillow 100.7/150: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
3:14.231 shred Fluffy_Pillow 93.3/150: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:15.235 shred Fluffy_Pillow 85.9/150: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:16.241 shred Fluffy_Pillow 78.5/150: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:17.244 healing_touch Fluffy_Pillow 71.1/150: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
3:18.045 ferocious_bite Fluffy_Pillow 81.2/150: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
3:19.050 rake Fluffy_Pillow 68.8/150: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
3:20.055 lunar_inspiration Fluffy_Pillow 64.0/150: 43% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
3:21.060 shred Fluffy_Pillow 61.6/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
3:22.064 Waiting 0.700 sec 33.1/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
3:22.764 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
3:23.768 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
3:24.664 Waiting 2.638 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing
3:27.302 rip Fluffy_Pillow 52.0/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:28.562 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing
3:29.566 Waiting 1.322 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, cleansed_wisps_blessing
3:30.888 lunar_inspiration Fluffy_Pillow 27.2/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, cleansed_wisps_blessing
3:31.893 Waiting 0.200 sec 38.5/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, cleansed_wisps_blessing
3:32.093 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, cleansed_wisps_blessing
3:33.097 Waiting 1.952 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, cleansed_wisps_blessing
3:35.049 tigers_fury Fluffy_Pillow 34.0/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, cleansed_wisps_blessing
3:35.295 shred Fluffy_Pillow 96.7/100: 97% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, cleansed_wisps_blessing
3:36.299 shred Fluffy_Pillow 83.0/100: 83% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, cleansed_wisps_blessing
3:37.306 healing_touch Fluffy_Pillow 69.3/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, cleansed_wisps_blessing
3:38.199 savage_roar Fluffy_Pillow 79.4/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
3:39.202 rake Fluffy_Pillow 65.6/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
3:40.207 shred Fluffy_Pillow 41.9/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
3:41.210 shred Fluffy_Pillow 53.2/100: 53% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
3:42.215 healing_touch Fluffy_Pillow 24.5/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
3:43.107 Waiting 0.300 sec 34.5/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
3:43.407 rip Fluffy_Pillow 37.9/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:44.412 Waiting 0.519 sec 19.2/100: 19% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:45.951 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:46.955 Waiting 1.092 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:48.047 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
3:49.051 Waiting 0.400 sec 36.3/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:49.451 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:50.457 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:51.353 Waiting 0.655 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:52.008 rip Fluffy_Pillow 29.5/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:53.012 rake Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:54.018 Waiting 0.905 sec 17.1/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:54.923 shred Fluffy_Pillow 27.2/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
3:55.928 Waiting 0.200 sec 38.5/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:56.128 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:57.132 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:58.026 Waiting 4.258 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:02.284 savage_roar Fluffy_Pillow 69.9/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
4:03.288 ashamanes_frenzy Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:04.293 rake Fluffy_Pillow 52.5/100: 52% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
4:05.297 tigers_fury Fluffy_Pillow 28.8/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:05.297 healing_touch Fluffy_Pillow 88.8/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
4:06.191 rip Fluffy_Pillow 98.8/100: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_ancients_blessing
4:07.196 lunar_inspiration Fluffy_Pillow 95.1/100: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
4:08.201 shred Fluffy_Pillow 91.4/100: 91% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
4:09.208 shred Fluffy_Pillow 77.7/100: 78% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
4:10.215 healing_touch Fluffy_Pillow 49.0/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
4:11.110 Waiting 2.700 sec 59.1/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
4:13.810 ferocious_bite Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing, cleansed_wisps_blessing, jacins_ruse
4:14.814 rake Fluffy_Pillow 75.7/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
4:15.819 shred Fluffy_Pillow 52.0/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
4:16.823 shred Fluffy_Pillow 63.3/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
4:17.826 lunar_inspiration Fluffy_Pillow 34.5/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
4:18.829 healing_touch Fluffy_Pillow 45.8/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
4:19.723 Waiting 3.000 sec 55.8/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing, jacins_ruse
4:22.723 rip Fluffy_Pillow 89.5/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing, jacins_ruse
4:23.728 rake Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:24.731 shred Fluffy_Pillow 47.1/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:25.736 Waiting 1.989 sec 18.4/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:27.725 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:28.729 Waiting 2.357 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
4:31.086 lunar_inspiration Fluffy_Pillow 38.5/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
4:32.091 healing_touch Fluffy_Pillow 19.8/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:34.008 savage_roar Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
4:35.267 tigers_fury Fluffy_Pillow 15.4/100: 15% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:35.297 rake Fluffy_Pillow 75.8/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:36.301 shred Fluffy_Pillow 67.1/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:37.306 shred Fluffy_Pillow 53.3/100: 53% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:38.311 Waiting 0.100 sec 39.6/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:38.411 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:39.415 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:40.307 Waiting 2.961 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:43.268 rip Fluffy_Pillow 55.3/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:44.274 rake Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:45.280 Waiting 1.074 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:46.354 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
4:47.357 Waiting 0.400 sec 36.3/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:47.757 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:48.761 Waiting 1.354 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:50.115 shred Fluffy_Pillow 27.2/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
4:51.118 healing_touch Fluffy_Pillow 38.5/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:52.012 Waiting 2.900 sec 48.5/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:54.912 rip Fluffy_Pillow 81.1/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:55.916 rake Fluffy_Pillow 62.4/100: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:56.920 Waiting 0.200 sec 38.7/100: 39% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:57.120 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:58.125 Waiting 1.537 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:59.662 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, cleansed_sisters_blessing
5:00.666 Waiting 2.159 sec 13.0/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, cleansed_sisters_blessing
5:02.825 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, cleansed_sisters_blessing
5:03.831 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, cleansed_sisters_blessing
5:05.143 tigers_fury Fluffy_Pillow 29.2/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), cleansed_sisters_blessing
5:05.297 savage_roar Fluffy_Pillow 91.1/100: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, cleansed_sisters_blessing
5:06.301 shadowmeld Fluffy_Pillow 78.7/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
5:06.301 rake Fluffy_Pillow 78.7/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
5:06.301 auto_attack Fluffy_Pillow 43.7/100: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
5:07.304 shred Fluffy_Pillow 71.3/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
5:08.308 shred Fluffy_Pillow 99.0/100: 99% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
5:09.311 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:10.315 healing_touch Fluffy_Pillow 71.3/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:11.212 Waiting 0.700 sec 81.4/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:11.912 rip Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:12.916 shred Fluffy_Pillow 70.5/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:13.920 lunar_inspiration Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:14.926 Waiting 1.571 sec 23.1/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:16.497 rake Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:17.505 healing_touch Fluffy_Pillow 17.0/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
5:18.399 Waiting 0.400 sec 27.1/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:18.799 savage_roar Fluffy_Pillow 31.6/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:19.802 ashamanes_frenzy Fluffy_Pillow 42.9/100: 43% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:20.807 rake Fluffy_Pillow 54.1/100: 54% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
5:21.811 Waiting 0.900 sec 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:22.711 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:23.716 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:24.611 Waiting 5.978 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:30.589 rip Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
5:31.594 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:32.601 lunar_inspiration Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:33.604 Waiting 1.100 sec 27.9/100: 28% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
5:34.704 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
5:35.709 tigers_fury Fluffy_Pillow 11.5/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
5:35.709 shred Fluffy_Pillow 71.5/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
5:36.712 healing_touch Fluffy_Pillow 97.8/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:37.607 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
5:38.611 rake Fluffy_Pillow 96.3/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:39.614 shred Fluffy_Pillow 87.5/100: 88% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:40.616 shred Fluffy_Pillow 58.8/100: 59% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:41.620 shred Fluffy_Pillow 70.1/100: 70% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:42.626 lunar_inspiration Fluffy_Pillow 41.4/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:43.631 healing_touch Fluffy_Pillow 22.7/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:44.526 Waiting 5.000 sec 32.7/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:49.526 savage_roar Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:50.531 rake Fluffy_Pillow 60.2/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:51.535 Waiting 0.400 sec 36.5/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:51.935 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:52.941 Waiting 1.134 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:54.075 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
5:55.079 Waiting 0.400 sec 36.3/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:55.479 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:56.484 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:57.376 Waiting 0.360 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:57.736 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:01.040 rake Fluffy_Pillow 37.1/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:02.043 Waiting 1.534 sec 13.4/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:03.577 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:04.579 Waiting 1.168 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:05.747 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:05.747 berserk Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
6:05.747 potion Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
6:05.747 shred Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, potion_of_the_old_war
6:06.752 shred Fluffy_Pillow 91.3/150: 61% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, potion_of_the_old_war
6:07.757 healing_touch Fluffy_Pillow 97.6/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, potion_of_the_old_war
6:08.652 savage_roar Fluffy_Pillow 107.6/150: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, cleansed_ancients_blessing, potion_of_the_old_war
6:09.656 rake Fluffy_Pillow 113.9/150: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:10.659 shred Fluffy_Pillow 107.7/150: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:11.663 ferocious_bite Fluffy_Pillow 98.9/150: 66% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:12.667 shred Fluffy_Pillow 85.2/150: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:13.674 lunar_inspiration Fluffy_Pillow 76.5/150: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:14.680 shred Fluffy_Pillow 72.8/150: 49% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:15.685 healing_touch Fluffy_Pillow 64.1/150: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:16.578 ferocious_bite Fluffy_Pillow 74.2/150: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:17.582 rake Fluffy_Pillow 72.9/150: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:18.586 shred Fluffy_Pillow 66.7/150: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:19.591 shred Fluffy_Pillow 58.0/150: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:20.596 shred Fluffy_Pillow 49.3/150: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:21.600 healing_touch Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:22.494 Waiting 3.400 sec 50.6/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse, potion_of_the_old_war
6:25.894 ferocious_bite Fluffy_Pillow 88.8/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:26.900 rake Fluffy_Pillow 50.1/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:27.905 Waiting 0.400 sec 26.4/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:28.305 lunar_inspiration Fluffy_Pillow 30.9/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:29.310 Waiting 1.140 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:30.450 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:31.455 Waiting 0.400 sec 36.3/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
6:31.855 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
6:32.859 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:33.752 Waiting 1.659 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:35.411 savage_roar Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:36.415 tigers_fury Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
6:36.415 ashamanes_frenzy Fluffy_Pillow 72.0/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:37.420 rake Fluffy_Pillow 98.3/100: 98% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:38.427 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:39.323 ferocious_bite Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
6:40.329 shred Fluffy_Pillow 76.3/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:41.334 shred Fluffy_Pillow 47.6/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:42.338 Waiting 1.045 sec 18.9/100: 19% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:43.383 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:44.389 Waiting 2.565 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:46.954 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:47.957 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:48.851 Waiting 2.664 sec 22.0/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:51.515 savage_roar Fluffy_Pillow 52.0/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:53.793 rake Fluffy_Pillow 37.5/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
6:54.798 Waiting 1.493 sec 13.8/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:56.291 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:57.296 ferocious_bite Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:58.300 Waiting 2.621 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:00.921 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:01.924 shred Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
7:02.929 Waiting 0.953 sec 23.3/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:04.138 rake Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:05.144 Waiting 1.053 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:06.197 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:06.415 shred Fluffy_Pillow 87.4/100: 87% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:07.419 shred Fluffy_Pillow 73.7/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:08.422 healing_touch Fluffy_Pillow 60.0/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:09.316 Waiting 0.400 sec 70.0/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
7:09.716 ferocious_bite Fluffy_Pillow 89.5/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
7:10.723 shadowmeld Fluffy_Pillow 75.8/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
7:10.723 rake Fluffy_Pillow 75.8/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
7:10.723 auto_attack Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
7:11.727 lunar_inspiration Fluffy_Pillow 52.1/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
7:12.732 Waiting 0.600 sec 33.4/100: 33% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
7:13.332 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
7:14.338 shred Fluffy_Pillow 11.4/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
7:15.343 healing_touch Fluffy_Pillow 22.7/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:16.237 Waiting 5.000 sec 32.8/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:21.237 savage_roar Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing
7:22.241 shred Fluffy_Pillow 60.2/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_wisps_blessing
7:23.247 Waiting 0.600 sec 31.5/100: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing
7:23.847 rake Fluffy_Pillow 38.3/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing
7:24.852 Waiting 2.330 sec 14.6/100: 15% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
7:27.182 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
7:28.186 lunar_inspiration Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_wisps_blessing
7:29.189 healing_touch Fluffy_Pillow 23.3/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 37.07% 37.07% 7375
Haste 12.34% 12.34% 4010
Damage / Heal Versatility 7.65% 7.65% 3058
Attack Power 21649 19943 0
Mastery 58.30% 56.14% 7026
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 848.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Trinket2 Nature's Call
ilevel: 880, stats: { +348 Mastery, +348 Haste, +348 Crit }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="arcanocrystal_860 / call_880"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=unstable_arcanocrystal,id=141482
trinket2=natures_call,id=139334,bonus_id=1806
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=847.50
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=7375
# gear_haste_rating=2673
# gear_mastery_rating=7026
# gear_versatility_rating=3058
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

arcanocrystal_860 / pod_880 : 322494 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
322493.7 322493.7 393.2 / 0.122% 39391.5 / 12.2% 21151.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.2 15.2 Energy 30.05% 45.0 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcanocrystal_860 / pod_880 322494
Ashamane's Frenzy 14850 4.6% 6.1 78.36sec 1090263 1085419 Direct 91.7 9979 19954 13571 36.0%  
Periodic 30.3 132038 263838 179445 36.0% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.13 91.68 121.97 30.30 1.0045 0.6471 6680753.41 7265601.54 8.05 78521.35 1085418.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.67 64.00% 9979.41 7435 11859 9980.45 8955 11063 585505 860748 31.98
crit 33.01 36.00% 19954.02 14870 23719 19958.07 17967 22473 658602 968207 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.4 64.03% 132038.21 81974 163449 132063.86 117396 148407 2561088 2561088 0.00
crit 10.9 35.97% 263838.27 163948 326898 263815.52 230892 306353 2875558 2875558 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 38250 11.9% 19.0 22.15sec 906095 0 Periodic 150.9 83861 167804 114195 36.1% 43.3%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.01 0.00 150.87 150.87 0.0000 1.2910 17228139.35 17228139.35 0.00 88452.85 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.4 63.87% 83861.30 58 99005 83780.43 75428 91571 8080376 8080376 0.00
crit 54.5 36.13% 167804.48 116 198011 167624.12 145882 184573 9147763 9147763 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 29997 9.3% 532.7 0.84sec 25330 30069 Direct 532.7 18616 37223 25330 36.1%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 532.71 532.71 0.00 0.00 0.8424 0.0000 13493526.15 19836761.58 31.98 30069.01 30069.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 340.49 63.92% 18615.95 14488 20826 18615.87 18267 18896 6338542 9318257 31.98
crit 192.22 36.08% 37223.29 28976 41653 37222.83 36125 37882 7154985 10518505 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 7365 2.3% 11.5 40.63sec 288310 287025 Direct 11.5 200752 443940 288298 36.0%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.48 11.48 0.00 0.00 1.0045 0.0000 3309967.28 4865965.44 31.98 287024.57 287024.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.35 63.99% 200752.31 15521 256019 200373.19 86664 256019 1474766 2168046 31.98
crit 4.13 36.01% 443940.03 34301 565803 441005.95 0 565803 1835201 2697920 31.75
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Infested Ground 6305 2.0% 7.9 60.68sec 360898 0 Direct 77.7 26815 53634 36504 36.1%  

Stats details: infested_ground

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.86 77.66 0.00 0.00 0.0000 0.0000 2835047.42 2835047.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.61 63.87% 26815.23 19604 28181 26816.81 25535 27749 1330193 1330193 0.00
crit 28.06 36.13% 53634.02 39209 56362 53635.97 50008 55888 1504854 1504854 0.00
 
 

Action details: infested_ground

Static Values
  • id:221803
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221803
  • name:Infested Ground
  • school:shadow
  • tooltip:
  • description:Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.
 
Moonfire (lunar_inspiration) 23911 7.4% 31.7 14.31sec 339714 338202 Direct 31.7 33680 67363 45907 36.3%  
Periodic 264.5 25845 51680 35176 36.1% 97.1%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.66 31.66 264.47 264.47 1.0045 1.6513 10756517.00 10756517.00 0.00 22958.21 338202.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.17 63.70% 33679.69 26218 37689 33675.91 31535 35798 679299 679299 0.00
crit 11.49 36.30% 67362.73 52436 75377 67360.67 61176 73411 774249 774249 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 169.0 63.88% 25844.57 15 29314 25844.23 24656 26582 4366443 4366443 0.00
crit 95.5 36.12% 51679.51 29 58627 51678.63 48876 53529 4936526 4936526 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2336 0.7% 25.3 17.66sec 41530 0 Periodic 74.7 14061 0 14061 0.0% 8.2%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.29 0.00 74.70 74.70 0.0000 0.4970 1050309.91 1544055.06 31.98 28293.46 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.7 100.00% 14060.51 27 15789 14065.36 12902 14856 1050310 1544055 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 12139 3.7% 24.8 16.54sec 216926 0 Direct 24.8 159412 318733 216920 36.1%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.84 24.84 0.00 0.00 0.0000 0.0000 5389197.90 7922631.40 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.88 63.90% 159411.73 124406 178834 159386.55 147603 171058 2530745 3720434 31.98
crit 8.97 36.10% 318733.50 248812 357668 318734.07 279914 357668 2858453 4202197 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 70997 22.0% 47.5 9.49sec 672526 669523 Direct 47.5 85917 171973 117102 36.2%  
Periodic 223.7 86813 173219 117954 36.0% 95.2%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.50 47.50 223.68 223.68 1.0045 1.9146 31945643.88 31945643.88 0.00 67117.63 669523.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.29 63.77% 85916.60 40197 192359 85918.33 72908 98619 2602297 2602297 0.00
crit 17.21 36.23% 171973.36 80394 384718 172039.14 141382 219419 2959978 2959978 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.1 63.96% 86813.01 38 192359 86836.34 77878 93996 12419497 12419497 0.00
crit 80.6 36.04% 173218.79 83 384718 173223.77 146555 200352 13963873 13963873 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 85367 26.5% 23.1 15.26sec 1661492 1654073 Periodic 327.7 86155 172326 117259 36.1% 96.6%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.13 0.00 327.72 327.72 1.0045 1.3265 38429072.44 38429072.44 0.00 83913.23 1654072.76
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 209.4 63.90% 86154.77 58 99005 86141.68 80674 90062 18042033 18042033 0.00
crit 118.3 36.10% 172326.06 133 198011 172308.05 160687 180270 20387040 20387040 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 30977 9.6% 113.0 3.97sec 123176 122624 Direct 113.0 90466 180911 123179 36.2%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.04 113.04 0.00 0.00 1.0045 0.0000 13923302.28 20468573.20 31.98 122623.65 122623.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.16 63.83% 90466.48 63161 136190 90485.13 85587 96126 6527768 9596438 31.98
crit 40.88 36.17% 180911.26 126321 272380 180843.04 166620 199108 7395534 10872135 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
arcanocrystal_860 / pod_880
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / pod_880
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.03sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / pod_880
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / pod_880
  • harmful:false
  • if_expr:
 
Healing Touch 51.9 8.76sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 51.92 0.00 0.00 0.00 0.8399 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.8 24.41sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.80 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.75sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.34sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.18% 45.4(45.4) 15.1

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.80% 14.57% 0.0(0.0) 2.9

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 51.9 0.0 8.7sec 8.8sec 46.34% 46.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.54%
  • bloodtalons_2:27.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 44.9 1.6 9.9sec 9.5sec 6.66% 15.34% 1.6(1.6) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.66%

Trigger Attempt Success

  • trigger_pct:8.72%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.8 64.1sec 48.5sec 24.59% 24.68% 1.8(1.8) 6.4

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Leeching Pestilence 7.9 0.0 60.7sec 60.7sec 17.29% 17.37% 0.0(0.0) 7.7

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_leeching_pestilence
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:leech_rating
  • amount:2037.36

Stack Uptimes

  • leeching_pestilence_1:17.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221805
  • name:Leeching Pestilence
  • tooltip:Leech increased by $w1.
  • description:{$@spelldesc221803=Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.6sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 51.6 1.1 8.7sec 8.5sec 74.27% 74.28% 1.1(1.1) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.27%

Trigger Attempt Success

  • trigger_pct:98.70%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 7.5 11.3 51.5sec 24.4sec 94.30% 93.97% 202.2(202.2) 6.5

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:94.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.2sec 133.2sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.81% 28.88% 0.0(0.0) 14.9

Buff details

  • buff initial source:arcanocrystal_860 / pod_880
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
arcanocrystal_860 / pod_880
ferocious_bite Energy 23.0 395.7 17.2 34.5 8363.8
ferocious_bite Combo Points 11.5 54.0 4.7 4.7 61326.1
lunar_inspiration Energy 31.7 783.3 24.7 24.7 13731.9
rake Energy 47.5 1354.0 28.5 28.5 23592.7
rip Energy 23.1 466.3 20.2 20.2 82408.4
rip Combo Points 23.1 115.7 5.0 5.0 332283.5
savage_roar Energy 18.8 485.9 25.8 25.8 0.0
savage_roar Combo Points 18.8 94.0 5.0 5.0 0.0
shred Energy 113.0 3371.8 29.8 29.8 4129.4
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.50 47.50 (17.80%) 1.00 0.00 0.00%
tigers_fury Energy 15.21 912.03 (10.92%) 59.97 0.44 0.05%
ashamanes_frenzy Combo Points 6.13 18.38 (6.89%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.66 31.66 (11.86%) 1.00 0.00 0.00%
shred Combo Points 113.04 113.04 (42.35%) 1.00 0.00 0.00%
energy_regen Energy 2092.87 5249.70 (62.88%) 2.51 85.53 1.60%
clearcasting Energy 44.78 1527.10 (18.29%) 34.10 0.00 0.00%
ashamanes_energy Energy 45.44 659.87 (7.90%) 14.52 21.72 3.19%
primal_fury Combo Points 69.59 56.32 (21.10%) 0.81 13.27 19.07%
Resource RPS-Gain RPS-Loss
Energy 15.16 15.24
Combo Points 0.59 0.59
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 34.98 0.01 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.31 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.0%

Procs

Count Interval
clearcasting 46.4 9.5sec
clearcasting_wasted 1.6 116.8sec
primal_fury 69.6 6.4sec

Statistics & Data Analysis

Fight Length
Sample Data arcanocrystal_860 / pod_880 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data arcanocrystal_860 / pod_880 Damage Per Second
Count 2499
Mean 322493.69
Minimum 290606.78
Maximum 358610.04
Spread ( max - min ) 68003.26
Range [ ( max - min ) / 2 * 100% ] 10.54%
Standard Deviation 10029.6435
5th Percentile 305879.06
95th Percentile 338836.44
( 95th Percentile - 5th Percentile ) 32957.38
Mean Distribution
Standard Deviation 200.6330
95.00% Confidence Intervall ( 322100.45 - 322886.92 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3715
0.1 Scale Factor Error with Delta=300 858726
0.05 Scale Factor Error with Delta=300 3434904
0.01 Scale Factor Error with Delta=300 85872609
Priority Target DPS
Sample Data arcanocrystal_860 / pod_880 Priority Target Damage Per Second
Count 2499
Mean 322493.69
Minimum 290606.78
Maximum 358610.04
Spread ( max - min ) 68003.26
Range [ ( max - min ) / 2 * 100% ] 10.54%
Standard Deviation 10029.6435
5th Percentile 305879.06
95th Percentile 338836.44
( 95th Percentile - 5th Percentile ) 32957.38
Mean Distribution
Standard Deviation 200.6330
95.00% Confidence Intervall ( 322100.45 - 322886.92 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3715
0.1 Scale Factor Error with Delta=300 858726
0.05 Scale Factor Error with Delta=300 3434904
0.01 Scale Factor Error with Delta=300 85872609
DPS(e)
Sample Data arcanocrystal_860 / pod_880 Damage Per Second (Effective)
Count 2499
Mean 322493.69
Minimum 290606.78
Maximum 358610.04
Spread ( max - min ) 68003.26
Range [ ( max - min ) / 2 * 100% ] 10.54%
Damage
Sample Data arcanocrystal_860 / pod_880 Damage
Count 2499
Mean 145041477.02
Minimum 107693412.70
Maximum 183709321.91
Spread ( max - min ) 76015909.21
Range [ ( max - min ) / 2 * 100% ] 26.20%
DTPS
Sample Data arcanocrystal_860 / pod_880 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data arcanocrystal_860 / pod_880 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data arcanocrystal_860 / pod_880 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data arcanocrystal_860 / pod_880 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data arcanocrystal_860 / pod_880 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data arcanocrystal_860 / pod_880 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data arcanocrystal_860 / pod_880Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data arcanocrystal_860 / pod_880 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.58 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.58 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 7.86 use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
C 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
D 15.21 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
E 3.70 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
F 50.92 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
J 7.50 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
K 23.13 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
L 11.30 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
M 7.78 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
N 6.13 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
O 3.58 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
P 42.92 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
Q 31.66 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
R 113.04 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789QRDABRJRRFNKRPQRFMPRRRFKRRRRFLPQDO89RRFKRRRQRFLPRRFKPQRDBRFKPRRQFLPRRRFKNPFLPDQRRFKRRRRPFKPQRFLPRRRRFKPQDBRRFKRRRRFLPQPFRKRQDRFKNPRFLO89RQRFKRPRFLPDABQRRFKPRRFMRQRFMPRRRFKPQRRDRFJPRRQFKPRRQFKNPFDBJPRRFKQRRRPFKPQRRFJDPRRQRFKPRRFPQJPDBRQFKO89RRRFKNPQFJPRRFMDPQRRFLPQRERPQFPDABCKRRRRFLPRRRFMQPRFMPRQFLDPNFMRRRQFLPPEQRFPRDBRMRRRFLPQRR

Sample Sequence Table

time name target resources buffs
Pre flask arcanocrystal_860 / pod_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food arcanocrystal_860 / pod_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation arcanocrystal_860 / pod_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 77.1/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 62.2/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:03.014 tigers_fury Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, potion_of_the_old_war
0:03.014 berserk Fluffy_Pillow 97.3/100: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:03.014 use_item_ravaged_seed_pod Fluffy_Pillow 97.3/150: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:03.014 shred Fluffy_Pillow 97.3/150: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:04.017 savage_roar Fluffy_Pillow 107.3/150: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:05.022 shred Fluffy_Pillow 117.4/150: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:06.029 shred Fluffy_Pillow 127.6/150: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:07.034 healing_touch Fluffy_Pillow 122.7/150: 82% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:07.788 ashamanes_frenzy Fluffy_Pillow 134.0/150: 89% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:08.793 rip Fluffy_Pillow 149.1/150: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:09.797 shred Fluffy_Pillow 149.2/150: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:10.803 rake Fluffy_Pillow 144.3/150: 96% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:11.808 lunar_inspiration Fluffy_Pillow 141.9/150: 95% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
0:12.812 shred Fluffy_Pillow 141.9/150: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
0:13.816 healing_touch Fluffy_Pillow 137.0/150: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:14.572 ferocious_bite Fluffy_Pillow 148.4/150: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
0:15.576 rake Fluffy_Pillow 138.5/150: 92% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.581 shred Fluffy_Pillow 136.1/150: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.586 shred Fluffy_Pillow 131.2/150: 87% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.590 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, potion_of_the_old_war
0:19.594 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.349 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, potion_of_the_old_war
0:21.354 shred Fluffy_Pillow 85.1/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.359 shred Fluffy_Pillow 60.2/100: 60% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.364 Waiting 0.400 sec 35.3/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:23.764 shred Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.768 shred Fluffy_Pillow 16.4/100: 16% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:25.773 healing_touch Fluffy_Pillow 31.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:26.528 Waiting 0.700 sec 42.8/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:27.228 savage_roar Fluffy_Pillow 53.3/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:28.742 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:29.748 Waiting 0.987 sec 16.2/100: 16% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:30.735 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:31.740 Waiting 0.592 sec 16.1/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:32.842 tigers_fury Fluffy_Pillow 32.7/100: 33% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:33.014 shadowmeld Fluffy_Pillow 95.2/100: 95% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:33.014 rake Fluffy_Pillow 95.2/100: 95% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:33.014 auto_attack Fluffy_Pillow 60.2/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.018 shred Fluffy_Pillow 90.3/100: 90% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.023 shred Fluffy_Pillow 80.4/100: 80% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.028 healing_touch Fluffy_Pillow 70.5/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:36.784 Waiting 0.300 sec 81.9/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:37.084 rip Fluffy_Pillow 86.4/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:38.089 shred Fluffy_Pillow 71.5/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:39.093 shred Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:40.099 shred Fluffy_Pillow 21.7/100: 22% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury
0:41.104 lunar_inspiration Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:42.107 Waiting 1.908 sec 18.0/100: 18% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:44.015 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:45.020 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:45.889 Waiting 1.588 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:47.477 savage_roar Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:48.481 rake Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
0:49.485 Waiting 1.454 sec 23.2/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
0:50.939 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
0:51.942 Waiting 2.459 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:54.401 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:55.405 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:56.274 Waiting 0.789 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:57.063 rip Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:58.067 rake Fluffy_Pillow 42.4/100: 42% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
0:59.073 lunar_inspiration Fluffy_Pillow 19.0/100: 19% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
1:00.078 Waiting 0.900 sec 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:00.978 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:01.982 Waiting 1.072 sec 12.6/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:03.054 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:03.054 use_item_ravaged_seed_pod Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:03.054 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:04.059 healing_touch Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:04.928 Waiting 0.200 sec 81.6/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
1:05.128 rip Fluffy_Pillow 99.0/100: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
1:06.133 rake Fluffy_Pillow 95.6/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:07.137 shred Fluffy_Pillow 72.2/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:08.141 shred Fluffy_Pillow 43.8/100: 44% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:09.146 Waiting 1.332 sec 15.4/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:10.478 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:11.482 healing_touch Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, leeching_pestilence
1:12.350 savage_roar Fluffy_Pillow 22.4/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, leeching_pestilence
1:13.611 rake Fluffy_Pillow 37.0/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:14.614 shred Fluffy_Pillow 13.6/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
1:15.620 Waiting 1.300 sec 25.2/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:16.920 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:17.927 Waiting 2.438 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:20.365 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:21.371 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:22.242 Waiting 2.985 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:25.227 rip Fluffy_Pillow 56.2/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:26.232 ashamanes_frenzy Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:27.236 rake Fluffy_Pillow 49.4/100: 49% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:28.240 healing_touch Fluffy_Pillow 26.0/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:29.110 Waiting 1.000 sec 36.1/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:30.110 savage_roar Fluffy_Pillow 47.6/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:32.647 rake Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:33.651 tigers_fury Fluffy_Pillow 13.5/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:33.651 lunar_inspiration Fluffy_Pillow 73.5/100: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:34.654 shred Fluffy_Pillow 70.1/100: 70% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.659 shred Fluffy_Pillow 56.7/100: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:36.665 healing_touch Fluffy_Pillow 43.4/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:37.535 Waiting 0.100 sec 53.4/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
1:37.635 rip Fluffy_Pillow 54.6/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
1:38.640 shred Fluffy_Pillow 66.2/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:39.644 Waiting 0.200 sec 37.8/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
1:39.844 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
1:40.849 Waiting 1.151 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:42.000 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
1:43.005 Waiting 0.300 sec 36.6/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:43.305 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:44.309 Waiting 1.453 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:46.529 rake Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:47.534 healing_touch Fluffy_Pillow 13.9/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:48.402 Waiting 5.600 sec 24.0/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:54.002 rip Fluffy_Pillow 88.7/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:55.007 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:56.011 lunar_inspiration Fluffy_Pillow 46.9/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
1:57.015 shred Fluffy_Pillow 58.5/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
1:58.018 healing_touch Fluffy_Pillow 70.1/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:58.887 Waiting 0.800 sec 80.1/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:59.687 savage_roar Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:00.690 rake Fluffy_Pillow 60.9/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
2:01.694 shred Fluffy_Pillow 72.5/100: 73% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:02.699 shred Fluffy_Pillow 44.2/100: 44% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
2:03.705 shred Fluffy_Pillow 55.8/100: 56% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
2:04.710 shred Fluffy_Pillow 67.4/100: 67% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
2:05.714 healing_touch Fluffy_Pillow 79.0/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:06.583 rip Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:07.588 rake Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:08.593 lunar_inspiration Fluffy_Pillow 47.3/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:09.597 tigers_fury Fluffy_Pillow 28.9/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
2:09.597 use_item_ravaged_seed_pod Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:09.597 shred Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:10.602 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:11.608 healing_touch Fluffy_Pillow 86.6/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:12.477 rip Fluffy_Pillow 96.7/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:13.480 shred Fluffy_Pillow 93.3/100: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:14.484 shred Fluffy_Pillow 64.9/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:15.489 Waiting 0.400 sec 36.5/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:15.889 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:16.894 Waiting 1.064 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:17.958 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
2:18.963 healing_touch Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
2:19.831 savage_roar Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:22.366 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:23.370 Waiting 1.579 sec 12.5/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:24.949 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:27.998 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:29.001 Waiting 1.373 sec 12.6/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:30.374 healing_touch Fluffy_Pillow 28.5/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:31.242 shred Fluffy_Pillow 38.5/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons(2), savage_roar
2:32.248 Waiting 1.200 sec 50.1/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
2:33.448 rip Fluffy_Pillow 64.0/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
2:34.452 shred Fluffy_Pillow 45.6/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:35.456 Waiting 1.177 sec 17.2/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:36.633 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:37.636 Waiting 1.793 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:39.429 tigers_fury Fluffy_Pillow 33.1/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:39.597 shred Fluffy_Pillow 95.0/100: 95% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:40.602 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:41.472 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:42.476 ashamanes_frenzy Fluffy_Pillow 96.6/100: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:43.479 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
2:44.483 shred Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
2:45.487 healing_touch Fluffy_Pillow 48.2/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
2:46.357 savage_roar Fluffy_Pillow 58.3/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
2:47.361 shadowmeld Fluffy_Pillow 69.9/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
2:47.361 rake Fluffy_Pillow 69.9/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
2:47.361 auto_attack Fluffy_Pillow 34.9/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:48.366 shred Fluffy_Pillow 46.5/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:49.370 Waiting 1.099 sec 18.1/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:50.469 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:51.473 Waiting 2.393 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:53.866 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:54.870 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:55.739 Waiting 2.789 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:58.528 rip Fluffy_Pillow 53.9/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:59.531 shred Fluffy_Pillow 65.5/100: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:00.536 rake Fluffy_Pillow 37.1/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:01.539 shred Fluffy_Pillow 13.7/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
3:02.546 healing_touch Fluffy_Pillow 25.3/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:03.418 Waiting 3.200 sec 35.4/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:06.618 savage_roar Fluffy_Pillow 72.4/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:07.623 rake Fluffy_Pillow 44.0/100: 44% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:08.628 Waiting 0.782 sec 20.6/100: 21% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:09.410 tigers_fury Fluffy_Pillow 29.6/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:09.597 berserk Fluffy_Pillow 91.8/100: 92% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:09.597 use_item_ravaged_seed_pod Fluffy_Pillow 91.8/150: 61% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:09.597 lunar_inspiration Fluffy_Pillow 91.8/150: 61% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:10.601 shred Fluffy_Pillow 103.4/150: 69% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:11.605 shred Fluffy_Pillow 110.0/150: 73% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:12.609 healing_touch Fluffy_Pillow 136.6/150: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:13.479 rip Fluffy_Pillow 146.6/150: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence
3:14.484 rake Fluffy_Pillow 143.2/150: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:15.488 shred Fluffy_Pillow 137.3/150: 92% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:16.492 shred Fluffy_Pillow 148.9/150: 99% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:17.497 healing_touch Fluffy_Pillow 140.6/150: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:18.366 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, leeching_pestilence
3:19.372 shred Fluffy_Pillow 136.6/150: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, leeching_pestilence
3:20.377 lunar_inspiration Fluffy_Pillow 148.2/150: 99% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar
3:21.382 shred Fluffy_Pillow 144.8/150: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar
3:22.386 healing_touch Fluffy_Pillow 136.4/150: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:23.255 ferocious_bite Fluffy_Pillow 146.5/150: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:24.259 rake Fluffy_Pillow 133.1/150: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:25.262 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:26.267 shred Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:27.271 shred Fluffy_Pillow 43.2/100: 43% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:28.275 healing_touch Fluffy_Pillow 14.8/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:29.144 Waiting 5.300 sec 24.9/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:34.444 rip Fluffy_Pillow 86.1/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:35.448 rake Fluffy_Pillow 67.7/100: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:36.451 lunar_inspiration Fluffy_Pillow 44.3/100: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:37.457 Waiting 1.000 sec 25.9/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
3:38.457 shred Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness
3:39.460 shred Fluffy_Pillow 49.1/100: 49% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
3:40.466 tigers_fury Fluffy_Pillow 20.7/100: 21% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
3:40.466 shred Fluffy_Pillow 80.7/100: 81% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
3:41.472 healing_touch Fluffy_Pillow 67.3/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
3:42.340 savage_roar Fluffy_Pillow 77.3/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
3:43.343 rake Fluffy_Pillow 63.9/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:44.348 shred Fluffy_Pillow 55.5/100: 56% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
3:45.351 Waiting 1.200 sec 27.1/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
3:46.551 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
3:47.556 Waiting 1.573 sec 12.6/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
3:49.129 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:50.133 healing_touch Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:51.003 Waiting 0.722 sec 22.4/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:51.725 rip Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:53.241 rake Fluffy_Pillow 18.3/100: 18% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
3:54.247 Waiting 0.900 sec 29.9/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:55.147 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:56.152 Waiting 2.432 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:58.584 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:59.589 Waiting 1.857 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:01.446 lunar_inspiration Fluffy_Pillow 33.1/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:02.449 healing_touch Fluffy_Pillow 14.7/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:03.318 Waiting 1.500 sec 24.7/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:04.818 rip Fluffy_Pillow 42.0/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:05.823 ashamanes_frenzy Fluffy_Pillow 23.7/100: 24% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:06.827 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, jacins_ruse
4:07.831 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, jacins_ruse
4:10.238 tigers_fury Fluffy_Pillow 39.7/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
4:10.466 use_item_ravaged_seed_pod Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, jacins_ruse
4:10.466 savage_roar Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, leeching_pestilence, jacins_ruse
4:11.472 rake Fluffy_Pillow 86.6/100: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:12.476 shred Fluffy_Pillow 78.2/100: 78% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:13.480 shred Fluffy_Pillow 64.8/100: 65% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:14.486 healing_touch Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:15.356 rip Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
4:16.360 lunar_inspiration Fluffy_Pillow 58.1/100: 58% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:17.364 Waiting 0.100 sec 39.7/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:17.464 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:18.469 Waiting 2.384 sec 12.5/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, leeching_pestilence
4:20.853 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:21.859 Waiting 2.456 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:24.315 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:25.320 rake Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
4:26.323 healing_touch Fluffy_Pillow 23.2/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:27.192 Waiting 4.800 sec 33.3/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:31.992 rip Fluffy_Pillow 88.7/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:32.997 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:34.001 lunar_inspiration Fluffy_Pillow 46.9/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:35.006 Waiting 1.000 sec 28.5/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:36.006 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:37.010 Waiting 1.150 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
4:38.160 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
4:39.164 healing_touch Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:40.035 savage_roar Fluffy_Pillow 46.7/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
4:41.040 tigers_fury Fluffy_Pillow 18.3/100: 18% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:41.040 rake Fluffy_Pillow 78.3/100: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:42.045 shred Fluffy_Pillow 69.9/100: 70% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:43.047 shred Fluffy_Pillow 56.5/100: 56% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:44.051 lunar_inspiration Fluffy_Pillow 43.1/100: 43% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:45.056 Waiting 1.400 sec 24.7/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:46.456 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:47.462 healing_touch Fluffy_Pillow 12.5/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:48.333 rip Fluffy_Pillow 22.5/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
4:49.593 rake Fluffy_Pillow 37.1/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:50.598 Waiting 2.277 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:52.875 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:53.879 Waiting 2.458 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:56.337 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:57.342 Waiting 1.557 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:58.899 healing_touch Fluffy_Pillow 29.6/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:59.768 rake Fluffy_Pillow 39.7/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar
5:00.771 Waiting 1.257 sec 16.2/100: 16% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar
5:02.028 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar
5:03.032 Waiting 1.092 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:05.655 savage_roar Fluffy_Pillow 42.7/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons
5:08.702 rake Fluffy_Pillow 37.9/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:09.708 Waiting 1.107 sec 14.5/100: 15% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:10.815 tigers_fury Fluffy_Pillow 27.3/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:11.040 use_item_ravaged_seed_pod Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:11.040 shred Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:12.045 lunar_inspiration Fluffy_Pillow 76.5/100: 77% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:13.049 healing_touch Fluffy_Pillow 73.1/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:13.916 rip Fluffy_Pillow 83.1/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
5:14.921 shadowmeld Fluffy_Pillow 79.7/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:14.921 rake Fluffy_Pillow 79.7/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:14.921 auto_attack Fluffy_Pillow 44.7/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:15.925 shred Fluffy_Pillow 56.3/100: 56% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:16.928 Waiting 1.100 sec 27.9/100: 28% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:18.028 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:19.031 Waiting 2.405 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:21.436 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:22.441 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:23.311 Waiting 3.186 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:26.497 rip Fluffy_Pillow 58.5/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:27.501 ashamanes_frenzy Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:28.504 rake Fluffy_Pillow 51.7/100: 52% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:29.508 Waiting 0.200 sec 28.3/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:29.708 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
5:30.713 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
5:32.348 savage_roar Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
5:33.353 rake Fluffy_Pillow 42.7/100: 43% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:34.357 Waiting 0.491 sec 19.3/100: 19% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:34.848 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:35.851 Waiting 0.300 sec 36.6/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:36.151 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:37.154 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:38.022 Waiting 2.488 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:40.510 ferocious_bite Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:41.516 tigers_fury Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:41.516 rake Fluffy_Pillow 72.0/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:42.521 lunar_inspiration Fluffy_Pillow 63.6/100: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:43.526 shred Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:44.531 shred Fluffy_Pillow 46.9/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:45.536 healing_touch Fluffy_Pillow 18.5/100: 18% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:46.406 Waiting 5.200 sec 28.5/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
5:51.606 savage_roar Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:52.610 rake Fluffy_Pillow 60.2/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:53.614 Waiting 0.300 sec 36.8/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:53.914 lunar_inspiration Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:54.918 Waiting 1.569 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:56.487 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:57.491 Waiting 1.258 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:58.749 ferocious_bite Fluffy_Pillow 26.2/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:59.753 Waiting 2.459 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:02.212 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:03.216 Waiting 1.458 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:05.439 rake Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:06.444 Waiting 1.459 sec 13.9/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:07.903 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:08.907 Waiting 1.093 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:10.000 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:10.870 rake Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
6:11.875 tigers_fury Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
6:11.875 berserk Fluffy_Pillow 71.7/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
6:11.875 use_item_ravaged_seed_pod Fluffy_Pillow 71.7/150: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury
6:11.875 potion Fluffy_Pillow 71.7/150: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence
6:11.875 rip Fluffy_Pillow 71.7/150: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:12.881 shred Fluffy_Pillow 83.3/150: 56% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:13.886 shred Fluffy_Pillow 89.9/150: 60% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:14.890 shred Fluffy_Pillow 96.5/150: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:15.894 shred Fluffy_Pillow 88.1/150: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:16.898 healing_touch Fluffy_Pillow 79.7/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:17.766 savage_roar Fluffy_Pillow 89.7/150: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:18.769 rake Fluffy_Pillow 81.3/150: 54% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:19.773 shred Fluffy_Pillow 75.4/150: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:20.776 shred Fluffy_Pillow 67.0/150: 45% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
6:21.782 shred Fluffy_Pillow 58.6/150: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
6:22.786 healing_touch Fluffy_Pillow 70.2/150: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:23.655 ferocious_bite Fluffy_Pillow 80.3/150: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:24.659 lunar_inspiration Fluffy_Pillow 66.9/150: 45% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:25.665 rake Fluffy_Pillow 63.5/150: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:26.670 shred Fluffy_Pillow 57.6/150: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:27.674 healing_touch Fluffy_Pillow 49.2/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:28.544 Waiting 2.600 sec 59.3/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:31.144 ferocious_bite Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:32.150 rake Fluffy_Pillow 50.9/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:33.155 Waiting 1.100 sec 27.5/100: 28% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:34.255 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:35.259 Waiting 1.637 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:36.896 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:37.900 healing_touch Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:38.769 Waiting 1.524 sec 22.4/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:40.293 savage_roar Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:41.807 tigers_fury Fluffy_Pillow 17.5/100: 18% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
6:41.875 rake Fluffy_Pillow 78.3/100: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:42.879 ashamanes_frenzy Fluffy_Pillow 69.9/100: 70% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:43.883 healing_touch Fluffy_Pillow 96.5/100: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:44.752 ferocious_bite Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
6:45.757 shred Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:46.762 shred Fluffy_Pillow 48.2/100: 48% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:47.767 Waiting 1.746 sec 19.8/100: 20% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:49.513 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:50.516 Waiting 1.659 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:52.175 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:53.182 healing_touch Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:54.051 Waiting 3.821 sec 22.4/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:57.872 savage_roar Fluffy_Pillow 66.6/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:58.875 rake Fluffy_Pillow 38.2/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:59.880 Waiting 2.083 sec 14.8/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:01.963 rake Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:02.969 Waiting 0.923 sec 15.5/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:03.892 ferocious_bite Fluffy_Pillow 26.2/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:04.897 Waiting 1.658 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:06.555 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:07.562 shred Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
7:08.567 healing_touch Fluffy_Pillow 24.0/100: 24% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:09.437 rake Fluffy_Pillow 34.1/100: 34% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons(2), savage_roar
7:10.442 shred Fluffy_Pillow 45.7/100: 46% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, savage_roar
7:11.446 Waiting 0.667 sec 17.3/100: 17% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points savage_roar
7:12.113 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, savage_roar
7:12.113 use_item_ravaged_seed_pod Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, savage_roar, tigers_fury
7:12.113 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
7:13.119 ferocious_bite Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
7:14.124 shred Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:15.131 shred Fluffy_Pillow 63.2/100: 63% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:16.136 Waiting 0.500 sec 34.9/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:16.636 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:17.641 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:18.512 Waiting 2.532 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
7:21.044 savage_roar Fluffy_Pillow 51.6/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, leeching_pestilence
7:23.072 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:24.074 Waiting 1.661 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:25.735 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:26.742 Waiting 2.289 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
7:29.031 shred Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
7:30.035 shred Fluffy_Pillow 50.5/100: 50% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 36.08% 36.08% 7027
Haste 15.54% 15.54% 5052
Damage / Heal Versatility 7.65% 7.65% 3058
Attack Power 21649 19943 0
Mastery 56.30% 54.16% 6678
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 848.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Trinket2 Ravaged Seed Pod
ilevel: 880, stats: { +1043 Haste }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="arcanocrystal_860 / pod_880"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=unstable_arcanocrystal,id=141482
trinket2=ravaged_seed_pod,id=139320,bonus_id=1806
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=847.50
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=7027
# gear_haste_rating=3368
# gear_mastery_rating=6678
# gear_versatility_rating=3058
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

baseline : 285835 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
285835.0 285835.0 379.3 / 0.133% 36967.1 / 12.9% 19759.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.5 14.5 Energy 31.28% 42.2 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
baseline 285835
Ashamane's Frenzy 13881 4.9% 6.1 78.79sec 1024550 1020005 Direct 91.2 9529 19051 12746 33.8%  
Periodic 30.1 126081 251903 168696 33.9% 17.4%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.09 91.18 121.31 30.13 1.0045 0.6471 6244468.49 6790811.23 8.05 73798.60 1020004.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.37 66.21% 9529.17 7081 11329 9531.50 8645 10478 575277 845712 31.98
crit 30.81 33.79% 19050.51 14161 22657 19050.44 17156 21113 586920 862828 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.9 66.14% 126080.91 78070 156132 126106.77 110897 142790 2512190 2512190 0.00
crit 10.2 33.86% 251903.17 160044 312264 251878.31 212551 299615 2570082 2570082 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 33216 11.6% 18.0 23.35sec 830410 0 Periodic 140.7 79378 158831 106173 33.7% 40.2%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.99 0.00 140.71 140.71 0.0000 1.2870 14939069.60 14939069.60 0.00 82497.10 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.3 66.28% 79378.13 55 94573 79288.71 69403 86719 7402463 7402463 0.00
crit 47.5 33.72% 158831.16 110 189146 158664.21 132523 176126 7536607 7536607 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 26697 9.3% 493.3 0.91sec 24345 26765 Direct 493.3 18194 36395 24345 33.8%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 493.29 493.29 0.00 0.00 0.9096 0.0000 12009029.06 17654410.25 31.98 26764.77 26764.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 326.59 66.21% 18193.75 14216 20436 18193.52 17797 18490 5941903 8735160 31.98
crit 166.70 33.79% 36395.13 28433 40872 36394.40 35441 37299 6067126 8919250 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 5660 2.0% 9.9 47.92sec 257751 256594 Direct 9.9 182889 402372 257707 34.1%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.86 9.86 0.00 0.00 1.0045 0.0000 2541310.65 3735967.37 31.98 256594.37 256594.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.50 65.89% 182888.71 14594 251221 182542.60 0 241859 1188052 1746549 31.96
crit 3.36 34.11% 402371.71 32470 555198 395350.84 0 555198 1353258 1989418 31.44
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 21385 7.5% 31.5 14.38sec 305248 303889 Direct 31.5 32940 66006 44058 33.6%  
Periodic 241.9 25446 50885 34029 33.7% 96.6%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.52 31.52 241.89 241.89 1.0045 1.7972 9619906.67 9619906.67 0.00 20626.84 303888.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.92 66.39% 32940.27 25727 36982 32935.98 30609 34712 689161 689161 0.00
crit 10.59 33.61% 66005.73 51454 73964 66032.69 59447 73964 699214 699214 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 160.3 66.26% 25445.62 134 28764 25445.98 24622 26088 4078348 4078348 0.00
crit 81.6 33.74% 50885.33 268 57529 50880.75 48413 52812 4153184 4153184 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2133 0.7% 23.6 18.96sec 40677 0 Periodic 69.7 13764 0 13764 0.0% 7.7%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.57 0.00 69.67 69.67 0.0000 0.4974 958885.57 1409652.61 31.98 27674.26 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.7 100.00% 13764.01 27 15493 13765.75 12809 14460 958886 1409653 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 10831 3.7% 22.9 18.12sec 209967 0 Direct 22.9 156433 312910 209958 34.2%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.91 22.91 0.00 0.00 0.0000 0.0000 4811339.36 7073124.60 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.07 65.78% 156432.55 122075 175482 156394.80 142130 167852 2358108 3466642 31.98
crit 7.84 34.22% 312909.59 244149 350964 312718.61 0 350964 2453232 3606483 31.96
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 65486 22.9% 46.9 9.63sec 628682 625874 Direct 46.9 81243 162781 108713 33.7%  
Periodic 223.4 81497 163249 109063 33.7% 94.5%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.86 46.86 223.41 223.41 1.0045 1.9030 29460513.38 29460513.38 0.00 62386.47 625873.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.07 66.31% 81243.02 38283 183748 81228.68 68913 94692 2524208 2524208 0.00
crit 15.79 33.69% 162780.70 76565 367495 162720.79 130617 206814 2570259 2570259 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.1 66.28% 81496.66 36 183748 81513.19 73684 89766 12067328 12067328 0.00
crit 75.3 33.72% 163249.25 71 367495 163291.63 136982 191138 12298718 12298718 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 78748 27.6% 22.6 15.79sec 1565269 1558281 Periodic 324.9 81564 163060 109095 33.8% 95.5%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.65 0.00 324.91 324.91 1.0045 1.3226 35446224.11 35446224.11 0.00 78337.83 1558281.27
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 215.1 66.22% 81563.95 71 94573 81556.73 76395 85885 17548228 17548228 0.00
crit 109.8 33.78% 163059.72 127 189146 163049.81 150218 172844 17897996 17897996 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 27798 9.7% 105.7 4.24sec 118235 117706 Direct 105.7 88345 176857 118236 33.8%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.65 105.65 0.00 0.00 1.0045 0.0000 12491887.16 18364257.39 31.98 117705.86 117705.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.98 66.23% 88344.95 61977 133637 88353.93 82927 93697 6182006 9088135 31.98
crit 35.68 33.77% 176856.62 123954 267275 176798.38 156652 198492 6309881 9276122 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
baseline
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.07sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Healing Touch 48.9 9.31sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 48.86 0.00 0.00 0.00 0.8983 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.4 25.01sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.36 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.72sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.34sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.12% 10.19% 45.5(45.5) 15.1

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.80% 15.28% 0.0(0.0) 2.9

Buff details

  • buff initial source:baseline
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 48.8 0.0 9.3sec 9.3sec 45.59% 45.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:19.22%
  • bloodtalons_2:26.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 42.0 1.2 10.5sec 10.2sec 5.96% 15.07% 1.2(1.2) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:5.96%

Trigger Attempt Success

  • trigger_pct:8.76%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.8 64.0sec 48.7sec 24.57% 24.65% 1.8(1.8) 6.4

Buff details

  • buff initial source:baseline
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.6sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 48.6 1.4 9.2sec 9.0sec 74.45% 74.46% 1.4(1.4) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.45%

Trigger Attempt Success

  • trigger_pct:98.16%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.8 9.5 45.3sec 25.0sec 92.42% 92.16% 201.5(201.5) 7.8

Buff details

  • buff initial source:baseline
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:92.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.9sec 133.9sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.82% 29.33% 0.0(0.0) 15.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
baseline
ferocious_bite Energy 19.7 329.3 16.7 33.4 7718.4
ferocious_bite Combo Points 9.9 44.6 4.5 4.5 57027.2
lunar_inspiration Energy 31.5 782.1 24.8 24.8 12299.4
rake Energy 46.9 1334.4 28.5 28.5 22078.2
rip Energy 22.6 465.4 20.6 20.6 76164.6
rip Combo Points 22.6 113.2 5.0 5.0 313058.9
savage_roar Energy 18.4 480.4 26.2 26.2 0.0
savage_roar Combo Points 18.4 91.8 5.0 5.0 0.0
shred Energy 105.7 3112.9 29.5 29.5 4012.9
Resource Gains Type Count Total Average Overflow
rake Combo Points 46.86 46.86 (18.55%) 1.00 0.00 0.00%
tigers_fury Energy 15.22 912.59 (11.56%) 59.97 0.48 0.05%
ashamanes_frenzy Combo Points 6.09 18.28 (7.24%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.52 31.52 (12.47%) 1.00 0.00 0.00%
shred Combo Points 105.65 105.65 (41.81%) 1.00 0.00 0.00%
energy_regen Energy 1948.24 4880.83 (61.84%) 2.51 59.74 1.21%
clearcasting Energy 41.93 1434.63 (18.18%) 34.21 0.00 0.00%
ashamanes_energy Energy 45.46 664.41 (8.42%) 14.61 17.51 2.57%
primal_fury Combo Points 62.06 50.36 (19.93%) 0.81 11.71 18.86%
Resource RPS-Gain RPS-Loss
Energy 14.35 14.46
Combo Points 0.56 0.55
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 34.95 0.02 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.13 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.7%

Procs

Count Interval
clearcasting 43.2 10.2sec
clearcasting_wasted 1.2 125.4sec
primal_fury 62.1 7.2sec

Statistics & Data Analysis

Fight Length
Sample Data Druid_Feral_T19P Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Druid_Feral_T19P Damage Per Second
Count 2499
Mean 285834.99
Minimum 258055.47
Maximum 319392.40
Spread ( max - min ) 61336.93
Range [ ( max - min ) / 2 * 100% ] 10.73%
Standard Deviation 9674.8149
5th Percentile 270405.82
95th Percentile 301912.18
( 95th Percentile - 5th Percentile ) 31506.36
Mean Distribution
Standard Deviation 193.5350
95.00% Confidence Intervall ( 285455.67 - 286214.31 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4400
0.1 Scale Factor Error with Delta=300 799040
0.05 Scale Factor Error with Delta=300 3196163
0.01 Scale Factor Error with Delta=300 79904088
Priority Target DPS
Sample Data Druid_Feral_T19P Priority Target Damage Per Second
Count 2499
Mean 285834.99
Minimum 258055.47
Maximum 319392.40
Spread ( max - min ) 61336.93
Range [ ( max - min ) / 2 * 100% ] 10.73%
Standard Deviation 9674.8149
5th Percentile 270405.82
95th Percentile 301912.18
( 95th Percentile - 5th Percentile ) 31506.36
Mean Distribution
Standard Deviation 193.5350
95.00% Confidence Intervall ( 285455.67 - 286214.31 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4400
0.1 Scale Factor Error with Delta=300 799040
0.05 Scale Factor Error with Delta=300 3196163
0.01 Scale Factor Error with Delta=300 79904088
DPS(e)
Sample Data Druid_Feral_T19P Damage Per Second (Effective)
Count 2499
Mean 285834.99
Minimum 258055.47
Maximum 319392.40
Spread ( max - min ) 61336.93
Range [ ( max - min ) / 2 * 100% ] 10.73%
Damage
Sample Data Druid_Feral_T19P Damage
Count 2499
Mean 128522634.05
Minimum 93908684.96
Maximum 161191732.48
Spread ( max - min ) 67283047.52
Range [ ( max - min ) / 2 * 100% ] 26.18%
DTPS
Sample Data Druid_Feral_T19P Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Druid_Feral_T19P Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Druid_Feral_T19P Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Druid_Feral_T19P Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Druid_Feral_T19P Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Druid_Feral_T19P Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Druid_Feral_T19PTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Druid_Feral_T19P Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.55 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.55 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.22 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 4.23 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 47.86 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.83 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.65 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 9.53 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 5.63 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.09 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.55 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.31 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.52 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 105.65 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQQICAQQEMJQOPQELOQQEJQQQQEKOPQQEJOQQELPCN89QEJQQQEKQOPEJOQPCQEJOQQQPEIMOEJOPQEKCOQQQQEJOPQEJOPQECIOQQPEJOQQEOIPOCEMJQQQEKOPQEJOPQQEJCAN89QQQEJPQQQEIOQQQQEJOPQEKOCQQEJPOQQEJMOPEKOQQCPEJOQQQEKOPQEJQQQEOCJPQQEKOQQPEJOQQEKCN89PQQEJMQQELOPQEJOQQPEKCOQQQEDOPQEODQPQQQEIOCABQQQEDOPQQELQQQQEKOMPELOQQQCEJOPQEKOQPQEDOQQCPEKN89QDQEQ

Sample Sequence Table

time name target resources buffs
Pre flask baseline 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food baseline 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation baseline 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.008 shred Fluffy_Pillow 59.9/100: 60% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, bloodtalons, potion_of_the_old_war
0:03.012 shred Fluffy_Pillow 73.9/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, potion_of_the_old_war
0:04.018 savage_roar Fluffy_Pillow 47.9/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, potion_of_the_old_war
0:05.023 tigers_fury Fluffy_Pillow 21.9/100: 22% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:05.023 berserk Fluffy_Pillow 81.9/100: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:05.023 shred Fluffy_Pillow 81.9/150: 55% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:06.026 shred Fluffy_Pillow 90.8/150: 61% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:07.030 healing_touch Fluffy_Pillow 119.8/150: 80% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:07.785 ashamanes_frenzy Fluffy_Pillow 130.3/150: 87% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:08.790 rip Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons, berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:09.796 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:10.800 rake Fluffy_Pillow 144.0/150: 96% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:11.805 lunar_inspiration Fluffy_Pillow 140.4/150: 94% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:12.808 shred Fluffy_Pillow 139.4/150: 93% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:13.811 healing_touch Fluffy_Pillow 133.4/150: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:14.566 ferocious_bite Fluffy_Pillow 143.9/150: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
0:15.571 rake Fluffy_Pillow 145.3/150: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:16.574 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:17.579 shred Fluffy_Pillow 144.0/150: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:18.582 healing_touch Fluffy_Pillow 137.9/150: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:19.338 rip Fluffy_Pillow 148.4/150: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
0:20.341 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:21.346 shred Fluffy_Pillow 74.0/100: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:22.350 shred Fluffy_Pillow 87.9/100: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:23.354 shred Fluffy_Pillow 61.9/100: 62% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:24.359 healing_touch Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:25.113 Waiting 2.000 sec 46.4/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, jacins_ruse
0:27.113 savage_roar Fluffy_Pillow 74.2/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, jacins_ruse
0:28.117 rake Fluffy_Pillow 88.2/100: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
0:29.123 lunar_inspiration Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:30.128 shred Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:31.133 Waiting 0.100 sec 25.1/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:31.233 shred Fluffy_Pillow 26.5/100: 27% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:32.237 healing_touch Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:32.991 rip Fluffy_Pillow 51.0/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:34.250 rake Fluffy_Pillow 38.5/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, bloodtalons, predatory_swiftness, savage_roar
0:35.254 shred Fluffy_Pillow 52.5/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:36.258 shred Fluffy_Pillow 66.4/100: 66% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:37.265 healing_touch Fluffy_Pillow 80.4/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:38.019 ferocious_bite Fluffy_Pillow 90.9/100: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:39.026 lunar_inspiration Fluffy_Pillow 54.9/100: 55% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:40.029 tigers_fury Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:40.029 shadowmeld Fluffy_Pillow 98.9/100: 99% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:40.029 rake Fluffy_Pillow 98.9/100: 99% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:40.029 auto_attack Fluffy_Pillow 63.9/100: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:41.032 shred Fluffy_Pillow 91.9/100: 92% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:42.036 healing_touch Fluffy_Pillow 77.7/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:42.976 Waiting 0.100 sec 87.7/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:43.076 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
0:44.080 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:45.084 shred Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
0:46.089 shred Fluffy_Pillow 41.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
0:47.095 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
0:48.034 Waiting 3.651 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:51.685 savage_roar Fluffy_Pillow 61.4/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:52.690 Waiting 0.200 sec 32.1/100: 32% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:52.890 shred Fluffy_Pillow 34.3/100: 34% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
0:53.895 rake Fluffy_Pillow 45.0/100: 45% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
0:54.900 Waiting 0.894 sec 20.8/100: 21% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:55.794 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:56.799 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:57.738 Waiting 4.759 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:02.497 rip Fluffy_Pillow 72.1/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:03.502 rake Fluffy_Pillow 52.8/100: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:04.507 Waiting 1.100 sec 28.6/100: 29% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:05.607 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:06.612 Waiting 1.798 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:08.410 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:09.413 Waiting 1.300 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:10.713 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:10.713 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:11.716 healing_touch Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:12.654 rip Fluffy_Pillow 80.8/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:13.657 rake Fluffy_Pillow 76.5/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:14.663 shred Fluffy_Pillow 67.3/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
1:15.668 Waiting 0.200 sec 38.0/100: 38% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:15.868 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:16.871 Waiting 2.819 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
1:19.690 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
1:20.694 Waiting 1.734 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:22.428 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:23.434 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
1:25.652 savage_roar Fluffy_Pillow 34.8/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
1:26.657 ashamanes_frenzy Fluffy_Pillow 45.6/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:27.661 rake Fluffy_Pillow 56.3/100: 56% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
1:28.664 healing_touch Fluffy_Pillow 32.1/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:29.601 Waiting 4.000 sec 42.1/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:33.601 rip Fluffy_Pillow 84.9/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:34.607 rake Fluffy_Pillow 95.7/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:35.613 lunar_inspiration Fluffy_Pillow 71.4/100: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:36.619 shred Fluffy_Pillow 52.2/100: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:37.625 healing_touch Fluffy_Pillow 23.0/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:38.564 Waiting 0.700 sec 33.0/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:39.264 savage_roar Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:40.266 Waiting 1.287 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:41.553 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:41.553 rake Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:42.558 shred Fluffy_Pillow 75.8/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:43.563 shred Fluffy_Pillow 61.5/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:44.567 shred Fluffy_Pillow 47.2/100: 47% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:45.572 Waiting 2.153 sec 18.0/100: 18% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
1:47.725 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
1:48.730 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:49.668 Waiting 0.796 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:50.464 rip Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:52.749 rake Fluffy_Pillow 24.8/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:53.756 lunar_inspiration Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:54.759 Waiting 2.312 sec 16.3/100: 16% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:57.071 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:58.077 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:59.015 Waiting 4.194 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:03.209 rip Fluffy_Pillow 66.7/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:04.215 rake Fluffy_Pillow 47.5/100: 47% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:05.218 Waiting 0.665 sec 23.2/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:05.883 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:06.888 Waiting 2.799 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:09.687 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:10.693 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
2:11.631 tigers_fury Fluffy_Pillow 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
2:11.631 savage_roar Fluffy_Pillow 81.8/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
2:12.635 rake Fluffy_Pillow 67.6/100: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:13.641 shred Fluffy_Pillow 58.4/100: 58% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:14.647 shred Fluffy_Pillow 44.1/100: 44% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
2:15.650 Waiting 1.948 sec 14.9/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
2:17.598 lunar_inspiration Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
2:18.603 healing_touch Fluffy_Pillow 16.5/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
2:19.542 Waiting 3.100 sec 26.5/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:22.642 rip Fluffy_Pillow 59.7/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:23.647 rake Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:24.650 Waiting 2.326 sec 16.2/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:26.976 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:27.980 Waiting 2.734 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:30.714 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:31.718 Waiting 1.434 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:33.152 healing_touch Fluffy_Pillow 27.1/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:34.091 rake Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons(2), savage_roar
2:35.095 Waiting 0.600 sec 47.9/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
2:35.695 savage_roar Fluffy_Pillow 54.3/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons
2:36.700 Waiting 0.500 sec 25.1/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:37.200 lunar_inspiration Fluffy_Pillow 30.5/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:40.513 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:41.519 tigers_fury Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:41.631 healing_touch Fluffy_Pillow 72.9/100: 73% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:42.570 ashamanes_frenzy Fluffy_Pillow 82.9/100: 83% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:43.573 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, ashamanes_energy, savage_roar, tigers_fury
2:44.580 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:45.586 shred Fluffy_Pillow 85.8/100: 86% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:46.589 shred Fluffy_Pillow 56.5/100: 56% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
2:47.595 healing_touch Fluffy_Pillow 27.3/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
2:48.532 Waiting 0.700 sec 37.3/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:49.232 savage_roar Fluffy_Pillow 44.8/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
2:50.235 rake Fluffy_Pillow 55.5/100: 56% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:51.239 lunar_inspiration Fluffy_Pillow 31.3/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
2:52.245 shred Fluffy_Pillow 42.0/100: 42% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:53.249 healing_touch Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:54.188 Waiting 5.204 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:59.392 rip Fluffy_Pillow 78.5/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:00.397 rake Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:01.403 lunar_inspiration Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:02.409 shred Fluffy_Pillow 45.8/100: 46% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:03.414 Waiting 2.291 sec 16.5/100: 17% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:05.705 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:06.709 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:07.649 Waiting 0.994 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:08.643 rip Fluffy_Pillow 32.5/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:11.434 tigers_fury Fluffy_Pillow 32.4/100: 32% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:11.631 berserk Fluffy_Pillow 94.5/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:11.631 shadowmeld Fluffy_Pillow 94.5/150: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:11.631 rake Fluffy_Pillow 94.5/150: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:11.631 auto_attack Fluffy_Pillow 77.0/150: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:12.636 shred Fluffy_Pillow 102.7/150: 68% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:13.639 shred Fluffy_Pillow 108.4/150: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:14.643 shred Fluffy_Pillow 114.2/150: 76% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:15.647 healing_touch Fluffy_Pillow 104.9/150: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:16.585 rip Fluffy_Pillow 115.0/150: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury
3:17.589 lunar_inspiration Fluffy_Pillow 110.7/150: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury
3:18.593 shred Fluffy_Pillow 121.5/150: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury
3:19.597 shred Fluffy_Pillow 112.2/150: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:20.602 shred Fluffy_Pillow 103.0/150: 69% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness
3:21.609 healing_touch Fluffy_Pillow 93.7/150: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness
3:22.546 savage_roar Fluffy_Pillow 103.8/150: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk
3:23.550 rake Fluffy_Pillow 94.5/150: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), berserk, predatory_swiftness, savage_roar
3:24.556 shred Fluffy_Pillow 105.3/150: 70% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:25.562 shred Fluffy_Pillow 96.0/150: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar
3:26.565 shred Fluffy_Pillow 86.8/150: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, berserk, predatory_swiftness, savage_roar
3:27.566 shred Fluffy_Pillow 97.5/100: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:28.570 healing_touch Fluffy_Pillow 68.2/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:29.509 Waiting 1.100 sec 78.3/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:30.609 rip Fluffy_Pillow 90.0/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:31.614 rake Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:32.618 lunar_inspiration Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:33.622 Waiting 1.200 sec 27.3/100: 27% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:34.822 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:35.828 healing_touch Fluffy_Pillow 10.9/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:36.766 Waiting 1.881 sec 20.9/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:38.647 savage_roar Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:39.652 rake Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
3:40.657 Waiting 0.728 sec 22.6/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:41.385 tigers_fury Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:41.631 shred Fluffy_Pillow 93.0/100: 93% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:42.637 shred Fluffy_Pillow 78.7/100: 79% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:43.643 healing_touch Fluffy_Pillow 64.5/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:44.582 rip Fluffy_Pillow 74.6/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
3:45.585 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:46.591 rake Fluffy_Pillow 80.8/100: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:47.596 shred Fluffy_Pillow 56.5/100: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:48.600 Waiting 1.200 sec 27.3/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:49.800 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:50.805 healing_touch Fluffy_Pillow 10.9/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:51.744 Waiting 6.482 sec 20.9/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:58.226 rip Fluffy_Pillow 90.3/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:59.231 ashamanes_frenzy Fluffy_Pillow 71.0/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:00.237 rake Fluffy_Pillow 81.8/100: 82% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
4:01.241 lunar_inspiration Fluffy_Pillow 92.5/100: 93% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:02.245 healing_touch Fluffy_Pillow 73.3/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:03.184 Waiting 0.600 sec 83.3/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:03.784 savage_roar Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:04.789 rake Fluffy_Pillow 60.5/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:05.794 Waiting 0.400 sec 36.2/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:06.194 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:07.200 Waiting 2.780 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:09.980 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:10.986 Waiting 1.232 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:12.218 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:12.218 lunar_inspiration Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:13.223 healing_touch Fluffy_Pillow 80.7/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:14.162 rip Fluffy_Pillow 90.8/100: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:15.167 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:16.172 shred Fluffy_Pillow 90.8/100: 91% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
4:17.178 shred Fluffy_Pillow 61.5/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:18.181 Waiting 0.700 sec 32.3/100: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:18.881 shred Fluffy_Pillow 39.7/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
4:19.887 healing_touch Fluffy_Pillow 50.5/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:20.827 Waiting 2.600 sec 60.6/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:23.427 savage_roar Fluffy_Pillow 88.4/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:24.433 rake Fluffy_Pillow 99.2/100: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:25.438 lunar_inspiration Fluffy_Pillow 74.9/100: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:26.442 shred Fluffy_Pillow 55.6/100: 56% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
4:27.447 healing_touch Fluffy_Pillow 26.4/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:28.386 Waiting 0.500 sec 36.5/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:28.886 rip Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:29.891 shred Fluffy_Pillow 52.6/100: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:30.896 Waiting 1.657 sec 23.3/100: 23% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:32.553 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:33.557 Waiting 2.735 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:36.292 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:37.296 Waiting 1.234 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:39.551 healing_touch Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:40.489 rake Fluffy_Pillow 46.0/100: 46% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
4:41.493 Waiting 0.507 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
4:42.000 tigers_fury Fluffy_Pillow 27.1/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
4:42.218 rip Fluffy_Pillow 89.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
4:43.225 lunar_inspiration Fluffy_Pillow 85.2/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:44.229 shred Fluffy_Pillow 81.0/100: 81% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:45.233 shred Fluffy_Pillow 66.7/100: 67% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:46.238 healing_touch Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
4:47.177 savage_roar Fluffy_Pillow 47.5/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
4:48.182 rake Fluffy_Pillow 58.3/100: 58% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
4:49.186 Waiting 0.600 sec 34.0/100: 34% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:49.786 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:50.790 shred Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
4:51.793 Waiting 1.287 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:53.080 lunar_inspiration Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:54.082 healing_touch Fluffy_Pillow 16.4/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:55.020 Waiting 4.100 sec 26.5/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:59.120 rip Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:00.124 rake Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:01.129 Waiting 1.300 sec 26.8/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:02.429 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:03.435 Waiting 2.761 sec 11.5/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:06.196 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:07.202 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:08.139 Waiting 1.795 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:09.934 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:12.218 tigers_fury Fluffy_Pillow 25.5/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:12.218 shadowmeld Fluffy_Pillow 85.5/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:12.218 rake Fluffy_Pillow 85.5/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:12.218 auto_attack Fluffy_Pillow 50.5/100: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:13.223 lunar_inspiration Fluffy_Pillow 76.2/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:14.227 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:15.230 shred Fluffy_Pillow 85.7/100: 86% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:16.235 healing_touch Fluffy_Pillow 56.5/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:17.174 rip Fluffy_Pillow 66.5/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
5:18.178 ashamanes_frenzy Fluffy_Pillow 77.3/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:19.183 shred Fluffy_Pillow 88.0/100: 88% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:20.188 shred Fluffy_Pillow 98.8/100: 99% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:21.191 healing_touch Fluffy_Pillow 69.5/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:22.130 Waiting 1.000 sec 79.6/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:23.130 ferocious_bite Fluffy_Pillow 90.3/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:24.134 rake Fluffy_Pillow 51.0/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:25.140 lunar_inspiration Fluffy_Pillow 26.8/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
5:26.144 Waiting 0.300 sec 37.5/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:26.444 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:27.448 healing_touch Fluffy_Pillow 11.5/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
5:28.387 rip Fluffy_Pillow 21.5/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:29.902 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:30.907 Waiting 2.575 sec 13.5/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:33.482 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:34.488 Waiting 1.233 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:35.721 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
5:36.726 Waiting 0.300 sec 35.8/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:37.026 lunar_inspiration Fluffy_Pillow 39.0/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:38.033 healing_touch Fluffy_Pillow 19.7/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:38.974 Waiting 1.000 sec 29.8/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:39.974 savage_roar Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:42.005 tigers_fury Fluffy_Pillow 22.2/100: 22% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:42.218 rake Fluffy_Pillow 84.5/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:43.223 shred Fluffy_Pillow 75.3/100: 75% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:44.227 shred Fluffy_Pillow 61.0/100: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:45.231 shred Fluffy_Pillow 86.8/100: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:46.235 healing_touch Fluffy_Pillow 57.5/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:47.173 ferocious_bite Fluffy_Pillow 67.5/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:48.944 rake Fluffy_Pillow 36.5/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:49.947 Waiting 1.693 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
5:51.640 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:52.645 Waiting 2.799 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:55.444 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:56.448 Waiting 1.234 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:57.682 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:58.619 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons(2), savage_roar
5:59.622 Waiting 2.800 sec 45.8/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
6:02.422 ferocious_bite Fluffy_Pillow 75.7/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
6:03.427 Waiting 0.400 sec 36.5/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
6:03.827 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
6:04.831 Waiting 1.762 sec 11.5/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:06.593 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness
6:07.598 Waiting 1.298 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
6:08.896 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness
6:09.900 Waiting 0.300 sec 35.7/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
6:10.200 shred Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness
6:11.204 shred Fluffy_Pillow 49.7/100: 50% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
6:12.209 healing_touch Fluffy_Pillow 60.4/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
6:13.148 savage_roar Fluffy_Pillow 70.5/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
6:14.151 rake Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:15.155 tigers_fury Fluffy_Pillow 17.0/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
6:15.155 berserk Fluffy_Pillow 77.0/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:15.155 potion Fluffy_Pillow 77.0/150: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
6:15.155 shred Fluffy_Pillow 77.0/150: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:16.161 shred Fluffy_Pillow 102.7/150: 68% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:17.168 shred Fluffy_Pillow 108.5/150: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:18.172 healing_touch Fluffy_Pillow 114.3/150: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:19.110 ferocious_bite Fluffy_Pillow 124.3/150: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:20.115 rake Fluffy_Pillow 110.0/150: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:21.118 lunar_inspiration Fluffy_Pillow 103.3/150: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:22.124 shred Fluffy_Pillow 99.0/150: 66% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:23.130 shred Fluffy_Pillow 89.8/150: 60% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:24.136 healing_touch Fluffy_Pillow 80.6/150: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:25.076 ferocious_bite Fluffy_Pillow 90.6/150: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:26.081 shred Fluffy_Pillow 88.9/150: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:27.086 shred Fluffy_Pillow 79.6/150: 53% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:28.092 shred Fluffy_Pillow 70.4/150: 47% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:29.098 shred Fluffy_Pillow 61.2/150: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:30.103 healing_touch Fluffy_Pillow 51.9/150: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:31.041 savage_roar Fluffy_Pillow 62.0/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, potion_of_the_old_war
6:32.044 rake Fluffy_Pillow 72.7/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, potion_of_the_old_war
6:33.047 ashamanes_frenzy Fluffy_Pillow 48.4/100: 48% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:34.182 lunar_inspiration Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:35.189 healing_touch Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:36.128 Waiting 3.600 sec 51.4/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:39.728 ferocious_bite Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, potion_of_the_old_war
6:40.733 rake Fluffy_Pillow 75.7/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:41.737 shred Fluffy_Pillow 51.4/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:42.742 Waiting 1.064 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:43.806 shred Fluffy_Pillow 33.6/100: 34% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
6:44.811 shred Fluffy_Pillow 44.3/100: 44% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:45.815 tigers_fury Fluffy_Pillow 15.0/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:45.815 healing_touch Fluffy_Pillow 75.0/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:46.755 Waiting 0.100 sec 85.1/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:46.855 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:47.860 rake Fluffy_Pillow 95.8/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:48.865 lunar_inspiration Fluffy_Pillow 86.5/100: 87% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
6:49.870 shred Fluffy_Pillow 67.3/100: 67% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
6:50.876 healing_touch Fluffy_Pillow 38.0/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
6:51.815 Waiting 3.900 sec 48.1/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
6:55.715 savage_roar Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:56.719 rake Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:57.722 Waiting 0.400 sec 36.3/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
6:58.122 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
6:59.128 Waiting 1.977 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:01.105 lunar_inspiration Fluffy_Pillow 32.5/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:02.107 Waiting 2.602 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:04.709 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:05.714 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:06.653 Waiting 0.394 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:07.047 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:10.355 rake Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:11.359 Waiting 2.295 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:13.654 shred Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
7:14.656 shred Fluffy_Pillow 46.4/100: 46% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:15.660 tigers_fury Fluffy_Pillow 17.2/100: 17% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:15.815 lunar_inspiration Fluffy_Pillow 78.8/100: 79% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:16.818 healing_touch Fluffy_Pillow 74.6/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:17.757 Waiting 0.100 sec 84.6/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
7:17.857 savage_roar Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
7:18.861 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
7:18.861 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
7:18.861 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
7:19.867 shred Fluffy_Pillow 75.8/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
7:20.869 ferocious_bite Fluffy_Pillow 46.5/100: 46% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
7:21.872 Waiting 2.833 sec 10.7/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
7:24.705 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:25.710 Waiting 2.733 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:28.443 healing_touch Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:29.384 shred Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 33.77% 33.77% 6220
Haste 7.01% 7.01% 2277
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 21649 19943 0
Mastery 51.70% 49.54% 5871
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 844.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="baseline"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=844.29
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=6220
# gear_haste_rating=1518
# gear_mastery_rating=5871
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

instinct_880 / appendages_880 : 331018 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
331018.4 331018.4 441.4 / 0.133% 43186.7 / 13.0% 22087.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.0 15.0 Energy 30.45% 43.3 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
instinct_880 / appendages_880 331018
Ashamane's Frenzy 15536 4.7% 6.1 78.46sec 1145374 1140261 Direct 91.3 10665 21319 14266 33.8%  
Periodic 30.2 141075 282038 188368 33.6% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.10 91.30 121.48 30.19 1.0045 0.6473 6988658.78 7600926.72 8.06 82453.29 1140260.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.44 66.20% 10665.11 7941 12656 10667.28 9741 11847 644594 947614 31.98
crit 30.86 33.80% 21318.56 15881 25311 21324.42 19287 23594 657841 967089 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.1 66.44% 141075.43 87552 174423 141115.75 128463 160658 2829533 2829533 0.00
crit 10.1 33.56% 282037.88 175104 348846 282109.83 221522 332344 2856691 2856691 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 38900 11.8% 18.6 22.83sec 942678 0 Periodic 146.6 89298 178577 119521 33.9% 42.0%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.58 0.00 146.58 146.58 0.0000 1.2895 17519324.69 17519324.69 0.00 92686.99 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.0 66.15% 89297.61 62 105654 89210.78 76424 97139 8657705 8657705 0.00
crit 49.6 33.85% 178576.86 124 211309 178374.05 148339 197219 8861619 8861619 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 29704 9.0% 519.2 0.87sec 25731 29850 Direct 519.2 19232 38466 25731 33.8%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 519.25 519.25 0.00 0.00 0.8620 0.0000 13360776.33 19641606.77 31.98 29850.48 29850.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 343.81 66.21% 19232.40 14990 21547 19232.07 18790 19534 6612239 9720618 31.98
crit 175.44 33.79% 38466.47 29979 43095 38466.14 37325 39288 6748537 9920988 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6920 2.1% 10.7 44.00sec 290952 289658 Direct 10.7 205823 457668 290930 33.8%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.68 10.68 0.00 0.00 1.0045 0.0000 3108609.35 4569950.20 31.98 289657.97 289657.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.07 66.20% 205822.81 15764 271087 205371.39 82323 271087 1455882 2140285 31.98
crit 3.61 33.80% 457668.05 35150 599103 449353.80 0 599103 1652727 2429665 31.44
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Horrific Slam 8145 2.5% 100.9 3.53sec 36331 0 Direct 100.9 27163 54294 36330 33.8%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.85 100.85 0.00 0.00 0.0000 0.0000 3664002.21 3664002.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.77 66.21% 27162.95 21142 30392 27162.43 24063 28915 1813668 1813668 0.00
crit 34.08 33.79% 54293.54 42285 60784 54293.01 48848 58670 1850334 1850334 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19015.64
  • base_dd_max:21017.28
 
Moonfire (lunar_inspiration) 24268 7.3% 31.6 14.33sec 345145 343609 Direct 31.6 35635 71232 47634 33.7%  
Periodic 256.4 27429 54862 36698 33.8% 97.0%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.63 31.63 256.41 256.41 1.0045 1.7015 10916472.54 10916472.54 0.00 23323.01 343609.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.97 66.29% 35635.50 27761 39907 35631.42 33762 37676 747170 747170 0.00
crit 10.66 33.71% 71231.75 55522 79813 71217.65 62463 78078 759456 759456 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 169.8 66.21% 27428.87 29 31039 27428.43 26340 28254 4656602 4656602 0.00
crit 86.6 33.79% 54862.21 29 62078 54859.55 52207 56844 4753244 4753244 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2253 0.7% 24.9 17.96sec 40760 0 Periodic 73.6 13777 0 13777 0.0% 8.1%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.86 0.00 73.55 73.55 0.0000 0.4970 1013381.00 1489766.06 31.98 27722.09 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.6 100.00% 13777.46 22 15493 13780.40 12902 14525 1013381 1489766 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11480 3.4% 24.3 16.86sec 209966 0 Direct 24.3 156704 313359 209969 34.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.29 24.29 0.00 0.00 0.0000 0.0000 5100520.80 7498248.71 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.03 66.00% 156703.68 122075 175482 156667.12 142130 167852 2512406 3693475 31.98
crit 8.26 34.00% 313358.99 244149 350964 313216.91 270599 350964 2588114 3804773 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 74080 22.4% 47.3 9.54sec 704859 701714 Direct 47.3 91364 183270 122249 33.6%  
Periodic 223.6 92063 184059 123186 33.8% 94.9%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.28 47.28 223.58 223.58 1.0045 1.9098 33323002.56 33323002.56 0.00 70229.39 701714.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.39 66.39% 91364.37 42933 205277 91393.24 78929 103082 2867764 2867764 0.00
crit 15.89 33.61% 183269.95 85866 410553 183129.56 139154 230533 2911885 2911885 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 147.9 66.17% 92062.51 40 205277 92075.36 81536 100899 13620317 13620317 0.00
crit 75.6 33.83% 184059.37 89 410553 184153.48 158396 222931 13923037 13923037 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 88976 26.9% 22.9 15.50sec 1751929 1744142 Periodic 326.5 91730 183504 122648 33.7% 96.1%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.86 0.00 326.54 326.54 1.0045 1.3246 40048999.76 40048999.76 0.00 87925.28 1744142.49
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 216.5 66.31% 91730.33 69 105654 91720.08 85593 95797 19863058 19863058 0.00
crit 110.0 33.69% 183504.45 124 211309 183497.01 164910 193090 20185942 20185942 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 30756 9.3% 110.9 4.04sec 124634 124076 Direct 110.9 93296 186429 124634 33.6%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.90 110.90 0.00 0.00 1.0045 0.0000 13822034.62 20319700.15 31.98 124075.71 124075.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.58 66.35% 93295.85 65348 140906 93318.23 87747 98838 6865026 10092239 31.98
crit 37.32 33.65% 186428.79 130695 281811 186362.21 167824 204977 6957008 10227461 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
instinct_880 / appendages_880
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_880 / appendages_880
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.03sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_880 / appendages_880
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_880 / appendages_880
  • harmful:false
  • if_expr:
 
Healing Touch 50.4 9.02sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.44 0.00 0.00 0.00 0.8597 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.6 24.66sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.60 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 132.88sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.34sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.18% 45.4(45.4) 15.1

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 14.85% 0.0(0.0) 2.9

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Blood Frenzy 14.6 7.8 30.7sec 19.6sec 40.32% 40.39% 7.8(7.8) 14.1

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:40.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 8.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 50.4 0.0 9.0sec 9.0sec 45.63% 45.67% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.79%
  • bloodtalons_2:26.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 43.7 1.4 10.1sec 9.8sec 6.34% 15.18% 1.4(1.4) 0.0

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.34%

Trigger Attempt Success

  • trigger_pct:8.68%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Horrific Appendages 5.7 1.0 71.7sec 59.6sec 17.01% 17.11% 101.8(101.8) 5.6

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:17.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Jacin's Ruse 6.7 1.8 63.4sec 48.4sec 24.71% 24.80% 1.8(1.8) 6.4

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.3sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 50.1 1.2 8.9sec 8.7sec 74.66% 74.67% 1.2(1.2) 0.0

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.66%

Trigger Attempt Success

  • trigger_pct:98.47%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.2 10.4 47.9sec 24.7sec 93.46% 93.21% 201.5(201.5) 7.2

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.1sec 133.1sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.81% 29.13% 0.0(0.0) 14.9

Buff details

  • buff initial source:instinct_880 / appendages_880
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
instinct_880 / appendages_880
ferocious_bite Energy 21.4 363.2 17.0 34.0 8559.5
ferocious_bite Combo Points 10.7 49.5 4.6 4.6 62808.3
lunar_inspiration Energy 31.6 784.7 24.8 24.8 13912.4
rake Energy 47.3 1347.6 28.5 28.5 24727.8
rip Energy 22.9 465.5 20.4 20.4 86031.5
rip Combo Points 22.9 114.3 5.0 5.0 350383.2
savage_roar Energy 18.6 481.1 25.9 25.9 0.0
savage_roar Combo Points 18.6 93.0 5.0 5.0 0.0
shred Energy 110.9 3297.8 29.7 29.7 4191.3
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.27 47.27 (18.19%) 1.00 0.00 0.00%
tigers_fury Energy 15.21 912.11 (11.14%) 59.97 0.53 0.06%
ashamanes_frenzy Combo Points 6.10 18.30 (7.04%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.63 31.63 (12.17%) 1.00 0.00 0.00%
shred Combo Points 110.90 110.90 (42.68%) 1.00 0.00 0.00%
energy_regen Energy 2106.65 5128.22 (62.62%) 2.43 76.69 1.47%
clearcasting Energy 43.57 1487.83 (18.17%) 34.15 0.00 0.00%
ashamanes_energy Energy 45.44 661.84 (8.08%) 14.56 19.77 2.90%
primal_fury Combo Points 63.86 51.76 (19.92%) 0.81 12.10 18.95%
Resource RPS-Gain RPS-Loss
Energy 14.89 14.98
Combo Points 0.58 0.57
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 36.68 0.02 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.04 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.9%

Procs

Count Interval
clearcasting 45.1 9.8sec
clearcasting_wasted 1.4 122.7sec
primal_fury 63.9 7.0sec

Statistics & Data Analysis

Fight Length
Sample Data instinct_880 / appendages_880 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data instinct_880 / appendages_880 Damage Per Second
Count 2499
Mean 331018.36
Minimum 291827.56
Maximum 376183.92
Spread ( max - min ) 84356.37
Range [ ( max - min ) / 2 * 100% ] 12.74%
Standard Deviation 11257.7935
5th Percentile 312694.70
95th Percentile 349316.16
( 95th Percentile - 5th Percentile ) 36621.46
Mean Distribution
Standard Deviation 225.2009
95.00% Confidence Intervall ( 330576.97 - 331459.74 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4443
0.1 Scale Factor Error with Delta=300 1081907
0.05 Scale Factor Error with Delta=300 4327630
0.01 Scale Factor Error with Delta=300 108190772
Priority Target DPS
Sample Data instinct_880 / appendages_880 Priority Target Damage Per Second
Count 2499
Mean 331018.36
Minimum 291827.56
Maximum 376183.92
Spread ( max - min ) 84356.37
Range [ ( max - min ) / 2 * 100% ] 12.74%
Standard Deviation 11257.7935
5th Percentile 312694.70
95th Percentile 349316.16
( 95th Percentile - 5th Percentile ) 36621.46
Mean Distribution
Standard Deviation 225.2009
95.00% Confidence Intervall ( 330576.97 - 331459.74 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4443
0.1 Scale Factor Error with Delta=300 1081907
0.05 Scale Factor Error with Delta=300 4327630
0.01 Scale Factor Error with Delta=300 108190772
DPS(e)
Sample Data instinct_880 / appendages_880 Damage Per Second (Effective)
Count 2499
Mean 331018.36
Minimum 291827.56
Maximum 376183.92
Spread ( max - min ) 84356.37
Range [ ( max - min ) / 2 * 100% ] 12.74%
Damage
Sample Data instinct_880 / appendages_880 Damage
Count 2499
Mean 148865782.64
Minimum 106161280.16
Maximum 192188913.38
Spread ( max - min ) 86027633.22
Range [ ( max - min ) / 2 * 100% ] 28.89%
DTPS
Sample Data instinct_880 / appendages_880 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data instinct_880 / appendages_880 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data instinct_880 / appendages_880 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data instinct_880 / appendages_880 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data instinct_880 / appendages_880 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data instinct_880 / appendages_880 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data instinct_880 / appendages_880Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data instinct_880 / appendages_880 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.57 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.57 auto_attack
0.00 skull_bash
A 2.95 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.21 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 3.91 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 49.44 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.15 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.86 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 10.45 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 6.77 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.10 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.57 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.71 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.63 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 110.90 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQCAQIQQQQEJMOELPOQQQEJQQQEKOPQQQCEJN89QQPELQQQOEIOPQEJCOQQQEJOPQQEIOMPEJOQCQQEJQQPQEIOQQPEJOQQQCEJOPQQEIOQQQEJOPQQEKOCQPQQEJMQEJOPQQEICAN89PQEJQQQELQOQPQEJOQQEIQOQELCOPQEJQQQQEKOPOEJMCQPEJOQQQQEIOPQQEJOPCQQEJOQQQEIOPQEOJQPQQCQEJN89QQQEIQMPEJOQQEKOPCOQQEDQPQOEKODPQEOCABJQQQQQEKOPQELQQQQELOPQEKMOQELCPQQQQEKOPDQQEOCN89LPQQEKQQQE

Sample Sequence Table

time name target resources buffs
Pre flask instinct_880 / appendages_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food instinct_880 / appendages_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation instinct_880 / appendages_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 60.0/100: 60% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:03.014 tigers_fury Fluffy_Pillow 33.9/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, potion_of_the_old_war
0:03.014 berserk Fluffy_Pillow 93.9/100: 94% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:03.014 shred Fluffy_Pillow 93.9/150: 63% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:04.018 savage_roar Fluffy_Pillow 102.9/150: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:05.022 shred Fluffy_Pillow 111.9/150: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:06.026 shred Fluffy_Pillow 120.8/150: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:07.032 shred Fluffy_Pillow 114.8/150: 77% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:08.037 shred Fluffy_Pillow 108.8/150: 73% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:09.040 healing_touch Fluffy_Pillow 102.8/150: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:09.794 rip Fluffy_Pillow 113.2/150: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:10.798 ashamanes_frenzy Fluffy_Pillow 112.2/150: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:11.804 rake Fluffy_Pillow 126.2/150: 84% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:12.808 healing_touch Fluffy_Pillow 122.7/150: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:13.562 ferocious_bite Fluffy_Pillow 133.2/150: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
0:14.566 lunar_inspiration Fluffy_Pillow 122.1/150: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:15.569 rake Fluffy_Pillow 121.1/150: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.574 shred Fluffy_Pillow 135.1/150: 90% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.577 shred Fluffy_Pillow 149.0/150: 99% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.581 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:19.587 healing_touch Fluffy_Pillow 74.0/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.342 Waiting 0.200 sec 84.5/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, potion_of_the_old_war
0:20.542 rip Fluffy_Pillow 87.3/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, potion_of_the_old_war
0:21.544 shred Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.547 shred Fluffy_Pillow 45.2/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.552 shred Fluffy_Pillow 59.2/100: 59% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:24.556 healing_touch Fluffy_Pillow 73.1/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:25.313 Waiting 0.200 sec 83.6/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:25.513 savage_roar Fluffy_Pillow 86.4/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:26.516 rake Fluffy_Pillow 60.4/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:27.519 lunar_inspiration Fluffy_Pillow 39.3/100: 39% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:28.524 Waiting 1.221 sec 23.3/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:29.745 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:30.751 Waiting 1.869 sec 14.3/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:32.620 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:33.624 shred Fluffy_Pillow 54.3/100: 54% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:34.628 tigers_fury Fluffy_Pillow 28.2/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, horrific_appendages
0:34.628 healing_touch Fluffy_Pillow 88.2/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
0:35.383 rip Fluffy_Pillow 98.7/100: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, horrific_appendages
0:36.389 shadowmeld Fluffy_Pillow 97.7/100: 98% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
0:36.389 rake Fluffy_Pillow 97.7/100: 98% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
0:36.389 auto_attack Fluffy_Pillow 62.7/100: 63% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
0:37.391 shred Fluffy_Pillow 91.7/100: 92% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
0:38.396 shred Fluffy_Pillow 80.6/100: 81% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
0:39.400 lunar_inspiration Fluffy_Pillow 94.6/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
0:40.404 healing_touch Fluffy_Pillow 78.6/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
0:41.133 ferocious_bite Fluffy_Pillow 88.2/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, horrific_appendages, blood_frenzy
0:42.138 shred Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, blood_frenzy
0:43.144 Waiting 1.498 sec 22.6/100: 23% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
0:44.642 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
0:45.647 Waiting 2.296 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
0:47.943 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:50.992 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:51.997 healing_touch Fluffy_Pillow 14.9/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:54.108 savage_roar Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), horrific_appendages, blood_frenzy
0:57.153 rake Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
0:58.157 Waiting 1.365 sec 14.5/100: 15% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
0:59.522 lunar_inspiration Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy, jacins_ruse
1:00.529 Waiting 1.800 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
1:02.329 shred Fluffy_Pillow 32.5/100: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
1:03.333 healing_touch Fluffy_Pillow 43.2/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
1:04.271 rip Fluffy_Pillow 53.3/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
1:05.276 tigers_fury Fluffy_Pillow 34.0/100: 34% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:05.276 rake Fluffy_Pillow 94.0/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:06.280 shred Fluffy_Pillow 84.8/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:07.284 shred Fluffy_Pillow 70.5/100: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:08.288 shred Fluffy_Pillow 56.3/100: 56% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:09.292 healing_touch Fluffy_Pillow 27.0/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:10.230 Waiting 4.700 sec 37.0/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
1:14.930 rip Fluffy_Pillow 88.1/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:15.934 rake Fluffy_Pillow 70.2/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
1:16.939 lunar_inspiration Fluffy_Pillow 47.4/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:17.945 Waiting 0.900 sec 29.6/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:18.845 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, blood_frenzy
1:19.848 shred Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, blood_frenzy
1:20.854 healing_touch Fluffy_Pillow 24.9/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, blood_frenzy
1:22.194 savage_roar Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), blood_frenzy
1:25.244 rake Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
1:26.248 ashamanes_frenzy Fluffy_Pillow 12.6/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:27.253 lunar_inspiration Fluffy_Pillow 23.6/100: 24% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:28.258 healing_touch Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:29.086 Waiting 3.200 sec 45.9/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
1:32.286 rip Fluffy_Pillow 84.6/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
1:33.291 rake Fluffy_Pillow 66.8/100: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:34.296 shred Fluffy_Pillow 44.0/100: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:35.299 tigers_fury Fluffy_Pillow 16.1/100: 16% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:35.299 shred Fluffy_Pillow 76.1/100: 76% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:36.304 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:37.309 healing_touch Fluffy_Pillow 86.8/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:38.247 rip Fluffy_Pillow 96.8/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:39.252 shred Fluffy_Pillow 92.6/100: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:40.255 shred Fluffy_Pillow 63.3/100: 63% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
1:41.260 lunar_inspiration Fluffy_Pillow 34.1/100: 34% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:42.264 Waiting 2.250 sec 14.8/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:44.514 shred Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
1:45.521 healing_touch Fluffy_Pillow 49.7/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
1:46.458 savage_roar Fluffy_Pillow 59.7/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), jacins_ruse
1:47.463 rake Fluffy_Pillow 70.5/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
1:48.468 shred Fluffy_Pillow 46.2/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:49.473 Waiting 2.050 sec 17.0/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:51.523 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:52.526 Waiting 2.278 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:54.804 lunar_inspiration Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:55.808 healing_touch Fluffy_Pillow 22.9/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:56.637 rip Fluffy_Pillow 33.0/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
1:59.428 rake Fluffy_Pillow 36.8/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:00.431 Waiting 2.384 sec 13.4/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:02.815 shred Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
2:03.820 shred Fluffy_Pillow 49.7/100: 50% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
2:04.825 shred Fluffy_Pillow 60.4/100: 60% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:05.828 tigers_fury Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:05.828 healing_touch Fluffy_Pillow 91.1/100: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:06.765 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:07.770 rake Fluffy_Pillow 95.8/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:08.777 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:09.780 shred Fluffy_Pillow 96.4/100: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:10.783 shred Fluffy_Pillow 68.6/100: 69% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury, blood_frenzy
2:11.788 healing_touch Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, blood_frenzy
2:12.617 savage_roar Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), tigers_fury, blood_frenzy
2:13.622 rake Fluffy_Pillow 63.0/100: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:14.627 shred Fluffy_Pillow 75.2/100: 75% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:15.631 shred Fluffy_Pillow 47.3/100: 47% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:16.637 Waiting 1.750 sec 19.5/100: 20% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:18.387 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
2:19.392 healing_touch Fluffy_Pillow 52.8/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:20.328 Waiting 0.700 sec 62.8/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:21.028 rip Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:22.032 rake Fluffy_Pillow 81.1/100: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:23.037 lunar_inspiration Fluffy_Pillow 58.3/100: 58% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:24.043 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:25.049 Waiting 2.318 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:27.367 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:28.371 healing_touch Fluffy_Pillow 12.9/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:29.200 Waiting 3.668 sec 23.0/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
2:32.868 savage_roar Fluffy_Pillow 67.4/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
2:33.874 rake Fluffy_Pillow 39.6/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
2:34.878 Waiting 0.779 sec 16.8/100: 17% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:35.657 tigers_fury Fluffy_Pillow 26.2/100: 26% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:35.828 shred Fluffy_Pillow 88.3/100: 88% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:36.833 lunar_inspiration Fluffy_Pillow 75.5/100: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:37.836 shred Fluffy_Pillow 72.6/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:38.841 shred Fluffy_Pillow 59.8/100: 60% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:39.848 healing_touch Fluffy_Pillow 32.0/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:40.677 Waiting 1.300 sec 42.0/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
2:41.977 rip Fluffy_Pillow 57.8/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
2:42.981 ashamanes_frenzy Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:43.985 shred Fluffy_Pillow 52.1/100: 52% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:44.990 healing_touch Fluffy_Pillow 24.3/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:45.819 Waiting 4.300 sec 34.3/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, blood_frenzy
2:50.119 rip Fluffy_Pillow 84.1/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
2:51.127 rake Fluffy_Pillow 64.9/100: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
2:52.133 lunar_inspiration Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:53.138 Waiting 1.835 sec 21.4/100: 21% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:54.973 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:55.977 Waiting 2.734 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:58.711 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:59.715 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:02.440 savage_roar Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
3:05.738 tigers_fury Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
3:05.828 berserk Fluffy_Pillow 97.2/100: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:05.828 shadowmeld Fluffy_Pillow 97.2/150: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:05.828 rake Fluffy_Pillow 97.2/150: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:05.828 auto_attack Fluffy_Pillow 79.7/150: 53% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:06.834 lunar_inspiration Fluffy_Pillow 105.5/150: 70% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:07.840 shred Fluffy_Pillow 131.2/150: 87% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:08.846 healing_touch Fluffy_Pillow 137.0/150: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:09.782 rip Fluffy_Pillow 147.0/150: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, tigers_fury
3:10.786 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury
3:11.792 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:12.797 shred Fluffy_Pillow 140.8/150: 94% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:13.803 healing_touch Fluffy_Pillow 131.5/150: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:14.743 ferocious_bite Fluffy_Pillow 141.6/150: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:15.747 shred Fluffy_Pillow 127.3/150: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:16.751 rake Fluffy_Pillow 118.1/150: 79% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar
3:17.755 shred Fluffy_Pillow 111.3/150: 74% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar
3:18.762 lunar_inspiration Fluffy_Pillow 102.1/150: 68% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:19.769 shred Fluffy_Pillow 97.9/150: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar
3:20.775 healing_touch Fluffy_Pillow 88.6/150: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar
3:21.714 rip Fluffy_Pillow 98.7/100: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:22.718 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
3:23.722 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:24.728 shred Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
3:25.732 healing_touch Fluffy_Pillow 81.5/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:26.671 savage_roar Fluffy_Pillow 91.6/100: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
3:27.677 shred Fluffy_Pillow 62.3/100: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:28.681 Waiting 0.100 sec 34.5/100: 34% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
3:28.781 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
3:29.786 Waiting 1.000 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:30.786 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
3:31.791 healing_touch Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:32.618 Waiting 0.300 sec 47.2/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
3:32.918 ferocious_bite Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
3:33.923 Waiting 0.989 sec 13.0/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
3:35.681 tigers_fury Fluffy_Pillow 34.3/100: 34% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
3:35.828 rake Fluffy_Pillow 96.1/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
3:36.834 lunar_inspiration Fluffy_Pillow 88.3/100: 88% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
3:37.838 shred Fluffy_Pillow 85.2/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:38.843 healing_touch Fluffy_Pillow 71.0/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:39.783 Waiting 0.800 sec 81.0/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
3:40.583 rip Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
3:41.589 shred Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:42.594 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:43.600 shred Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:44.605 Waiting 1.721 sec 22.6/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:46.326 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:47.330 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:48.266 Waiting 1.798 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:50.064 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:53.370 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:54.375 Waiting 1.698 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:56.073 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:59.377 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
4:00.383 healing_touch Fluffy_Pillow 11.5/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:01.321 Waiting 0.826 sec 21.5/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:02.147 rip Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:03.150 ashamanes_frenzy Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:04.154 Waiting 1.497 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:05.651 tigers_fury Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:05.828 shred Fluffy_Pillow 99.7/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:06.833 lunar_inspiration Fluffy_Pillow 85.5/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:07.837 healing_touch Fluffy_Pillow 81.2/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:08.775 rip Fluffy_Pillow 91.3/100: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:09.779 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:10.785 shred Fluffy_Pillow 75.8/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
4:11.789 shred Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:12.793 Waiting 2.224 sec 17.3/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:15.017 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, jacins_ruse
4:16.022 Waiting 0.971 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, blood_frenzy, jacins_ruse
4:16.993 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, blood_frenzy, jacins_ruse
4:17.998 healing_touch Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, blood_frenzy, jacins_ruse
4:18.828 savage_roar Fluffy_Pillow 47.2/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), blood_frenzy, jacins_ruse
4:19.832 rake Fluffy_Pillow 59.4/100: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:20.837 lunar_inspiration Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:21.841 Waiting 1.816 sec 18.7/100: 19% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:23.657 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:24.661 Waiting 2.397 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:27.058 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:28.064 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:29.001 Waiting 0.816 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:29.817 rip Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:32.870 rake Fluffy_Pillow 33.0/100: 33% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:33.873 lunar_inspiration Fluffy_Pillow 43.7/100: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:34.877 Waiting 0.800 sec 24.5/100: 24% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:35.677 tigers_fury Fluffy_Pillow 33.0/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:35.828 shred Fluffy_Pillow 94.7/100: 95% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:36.833 shred Fluffy_Pillow 80.4/100: 80% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:37.837 healing_touch Fluffy_Pillow 66.2/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:38.775 Waiting 0.100 sec 76.2/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:38.875 rip Fluffy_Pillow 92.3/100: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:39.877 rake Fluffy_Pillow 73.0/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:40.882 shred Fluffy_Pillow 49.8/100: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:41.887 shred Fluffy_Pillow 22.0/100: 22% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:42.892 shred Fluffy_Pillow 34.1/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, tigers_fury, horrific_appendages, blood_frenzy
4:43.897 healing_touch Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, horrific_appendages, blood_frenzy
4:44.726 savage_roar Fluffy_Pillow 56.4/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), horrific_appendages, blood_frenzy
4:45.730 Waiting 0.300 sec 28.5/100: 29% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
4:46.285 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
4:47.289 Waiting 1.538 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
4:48.827 lunar_inspiration Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
4:49.832 Waiting 2.471 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
4:52.303 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
4:53.309 Waiting 1.918 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
4:55.227 healing_touch Fluffy_Pillow 31.4/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:56.166 rake Fluffy_Pillow 41.5/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
4:57.169 Waiting 2.629 sec 17.2/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
4:59.798 rip Fluffy_Pillow 45.3/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:00.803 Waiting 0.500 sec 26.1/100: 26% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:01.303 shred Fluffy_Pillow 31.4/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar
5:02.307 lunar_inspiration Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:03.313 shred Fluffy_Pillow 22.9/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
5:04.318 Waiting 0.600 sec 33.7/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:04.918 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:05.922 tigers_fury Fluffy_Pillow 10.9/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:05.922 shred Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:06.925 healing_touch Fluffy_Pillow 96.6/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:07.852 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
5:08.858 shadowmeld Fluffy_Pillow 97.2/100: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, tigers_fury, blood_frenzy
5:08.858 rake Fluffy_Pillow 97.2/100: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, tigers_fury, blood_frenzy
5:08.858 auto_attack Fluffy_Pillow 62.2/100: 62% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, blood_frenzy
5:09.862 shred Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury, blood_frenzy
5:10.865 shred Fluffy_Pillow 61.5/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury, blood_frenzy
5:11.869 Waiting 0.600 sec 33.7/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury, blood_frenzy, jacins_ruse
5:12.469 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury, blood_frenzy, jacins_ruse
5:13.474 healing_touch Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, tigers_fury, blood_frenzy, jacins_ruse
5:14.304 savage_roar Fluffy_Pillow 23.2/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), blood_frenzy, jacins_ruse
5:15.308 Waiting 0.400 sec 35.3/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
5:15.708 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
5:16.713 Waiting 1.242 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
5:17.955 ashamanes_frenzy Fluffy_Pillow 27.2/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:19.153 lunar_inspiration Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
5:20.156 healing_touch Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:21.095 rip Fluffy_Pillow 60.8/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:22.098 rake Fluffy_Pillow 41.5/100: 42% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:23.101 Waiting 2.224 sec 17.2/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:25.325 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:26.330 Waiting 1.233 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:27.563 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:28.570 healing_touch Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:29.509 Waiting 1.200 sec 45.8/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:30.709 savage_roar Fluffy_Pillow 59.5/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:32.228 rake Fluffy_Pillow 37.9/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
5:33.232 Waiting 1.316 sec 15.1/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:34.548 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:35.808 tigers_fury Fluffy_Pillow 16.3/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:35.922 rake Fluffy_Pillow 77.7/100: 78% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:36.925 shred Fluffy_Pillow 69.9/100: 70% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:37.930 shred Fluffy_Pillow 57.0/100: 57% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:38.934 healing_touch Fluffy_Pillow 44.2/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:39.765 ferocious_bite Fluffy_Pillow 54.3/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
5:40.769 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:41.772 Waiting 2.588 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
5:44.360 lunar_inspiration Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:45.363 Waiting 1.441 sec 23.3/100: 23% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:46.804 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:47.810 Waiting 1.195 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:49.773 rake Fluffy_Pillow 36.7/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
5:50.778 healing_touch Fluffy_Pillow 13.9/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
5:51.608 Waiting 0.300 sec 24.0/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages, blood_frenzy
5:51.908 savage_roar Fluffy_Pillow 27.6/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages, blood_frenzy
5:52.912 rake Fluffy_Pillow 39.8/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
5:53.916 Waiting 1.194 sec 16.5/100: 16% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
5:55.110 ferocious_bite Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
5:56.114 Waiting 2.332 sec 10.7/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:58.446 lunar_inspiration Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:59.450 Waiting 2.299 sec 16.4/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
6:01.749 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:02.755 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:04.968 rake Fluffy_Pillow 35.5/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar
6:05.974 tigers_fury Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
6:05.974 berserk Fluffy_Pillow 71.3/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
6:05.974 potion Fluffy_Pillow 71.3/150: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury
6:05.974 rip Fluffy_Pillow 71.3/150: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:06.978 shred Fluffy_Pillow 82.0/150: 55% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:07.981 shred Fluffy_Pillow 87.7/150: 58% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:08.986 shred Fluffy_Pillow 93.5/150: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:09.990 shred Fluffy_Pillow 84.2/150: 56% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:10.993 shred Fluffy_Pillow 95.0/150: 63% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:11.997 healing_touch Fluffy_Pillow 87.1/150: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:12.826 savage_roar Fluffy_Pillow 97.2/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:13.832 rake Fluffy_Pillow 89.4/150: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:14.836 lunar_inspiration Fluffy_Pillow 84.0/150: 56% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:15.840 shred Fluffy_Pillow 81.2/150: 54% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:16.844 healing_touch Fluffy_Pillow 73.4/150: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:17.673 ferocious_bite Fluffy_Pillow 83.4/150: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, blood_frenzy, potion_of_the_old_war
6:18.678 shred Fluffy_Pillow 70.6/150: 47% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:19.682 shred Fluffy_Pillow 62.7/150: 42% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:20.687 shred Fluffy_Pillow 54.9/150: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:21.693 shred Fluffy_Pillow 47.1/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:22.699 healing_touch Fluffy_Pillow 19.3/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:23.528 Waiting 4.900 sec 29.4/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, potion_of_the_old_war
6:28.428 ferocious_bite Fluffy_Pillow 88.7/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy, potion_of_the_old_war
6:29.433 rake Fluffy_Pillow 75.9/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:30.436 lunar_inspiration Fluffy_Pillow 53.1/100: 53% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:31.442 Waiting 0.400 sec 35.2/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:31.842 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:32.846 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:33.783 Waiting 1.764 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:35.547 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
6:36.552 ashamanes_frenzy Fluffy_Pillow 51.8/100: 52% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
6:37.556 rake Fluffy_Pillow 62.5/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
6:38.561 shred Fluffy_Pillow 73.3/100: 73% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:39.564 healing_touch Fluffy_Pillow 44.0/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:40.502 ferocious_bite Fluffy_Pillow 54.1/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:41.507 tigers_fury Fluffy_Pillow 14.8/100: 15% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:41.507 lunar_inspiration Fluffy_Pillow 74.8/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:42.511 shred Fluffy_Pillow 70.6/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:43.515 shred Fluffy_Pillow 56.3/100: 56% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:44.521 shred Fluffy_Pillow 42.1/100: 42% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
6:45.526 Waiting 2.637 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
6:48.163 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
6:49.168 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
6:50.106 Waiting 6.195 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:56.301 savage_roar Fluffy_Pillow 88.1/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:57.305 rake Fluffy_Pillow 58.9/100: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
6:58.308 lunar_inspiration Fluffy_Pillow 69.6/100: 70% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:59.313 ferocious_bite Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
7:00.316 Waiting 2.800 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:03.116 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:04.121 Waiting 2.733 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:06.854 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:09.906 healing_touch Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
7:10.737 rake Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
7:11.740 tigers_fury Fluffy_Pillow 23.4/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar, blood_frenzy
7:11.740 shadowmeld Fluffy_Pillow 83.4/100: 83% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
7:11.740 rake Fluffy_Pillow 83.4/100: 83% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points shadowmeld, bloodtalons, ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
7:11.740 auto_attack Fluffy_Pillow 48.4/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
7:12.745 Waiting 1.000 sec 75.6/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
7:13.745 ferocious_bite Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
7:14.749 lunar_inspiration Fluffy_Pillow 77.2/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:15.752 shred Fluffy_Pillow 59.3/100: 59% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:16.757 Waiting 0.800 sec 31.5/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:17.557 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:18.562 healing_touch Fluffy_Pillow 13.4/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:19.394 savage_roar Fluffy_Pillow 23.5/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
7:20.400 shred Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
7:21.404 shred Fluffy_Pillow 47.8/100: 48% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
7:22.407 Waiting 1.715 sec 20.0/100: 20% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:24.122 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:25.126 healing_touch Fluffy_Pillow 12.9/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:25.954 Waiting 4.169 sec 22.9/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 23361 21655 11591 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 28033 25986 0
Crit 33.77% 33.77% 6220
Haste 7.01% 7.01% 2277
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 23361 21655 0
Mastery 57.66% 55.50% 6914
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 849.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Spontaneous Appendages
ilevel: 880, stats: { +1043 Mastery }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="instinct_880 / appendages_880"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=spontaneous_appendages,id=139325,bonus_id=1806
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=848.75
# gear_agility=11591
# gear_stamina=17628
# gear_crit_rating=6220
# gear_haste_rating=1518
# gear_mastery_rating=6914
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

instinct_880 / arcanocrystal_860 : 339751 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
339751.1 339751.1 426.2 / 0.125% 42581.4 / 12.5% 22167.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.3 15.3 Energy 29.86% 44.2 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
instinct_880 / arcanocrystal_860 339751
Ashamane's Frenzy 16086 4.7% 6.1 78.30sec 1180042 1174877 Direct 91.7 10791 21571 14684 36.1%  
Periodic 30.3 142716 285480 194254 36.1% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.13 91.70 122.01 30.31 1.0045 0.6471 7233719.68 7866708.48 8.05 84989.60 1174877.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.59 63.89% 10791.10 8023 12797 10794.89 9847 11849 632260 929482 31.98
crit 33.11 36.11% 21571.23 16045 25594 21577.33 19596 23789 714253 1050020 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.4 63.90% 142716.39 88454 176371 142764.15 128453 158992 2764164 2764164 0.00
crit 10.9 36.10% 285480.22 176908 352742 285492.10 245093 340384 3123042 3123042 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 41423 12.2% 19.2 22.33sec 973314 0 Periodic 151.5 90489 180907 123098 36.1% 43.5%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.16 0.00 151.46 151.46 0.0000 1.2909 18646028.56 18646028.56 0.00 95365.37 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.8 63.93% 90488.60 63 106835 90401.46 79808 97778 8762000 8762000 0.00
crit 54.6 36.07% 180907.47 125 213669 180758.22 160002 198963 9884028 9884028 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 31863 9.4% 536.4 0.84sec 26717 31995 Direct 536.4 19636 39273 26717 36.1%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 536.44 536.44 0.00 0.00 0.8351 0.0000 14332305.53 21069846.73 31.98 31994.97 31994.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 343.00 63.94% 19636.25 15276 21959 19636.40 19280 19894 6735199 9901381 31.98
crit 193.44 36.06% 39272.57 30552 43918 39272.06 38305 40070 7597106 11168466 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 8174 2.4% 11.7 40.04sec 315281 313883 Direct 11.7 218248 483584 315233 36.6%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.66 11.66 0.00 0.00 1.0045 0.0000 3676506.91 5404813.40 31.98 313882.60 313882.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.40 63.44% 218248.33 16046 276265 217941.95 55253 276265 1614388 2373303 31.98
crit 4.26 36.56% 483583.92 36955 610546 478474.86 0 610546 2062119 3031511 31.68
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 25964 7.6% 31.7 14.30sec 368564 366918 Direct 31.7 36383 72721 49522 36.2%  
Periodic 265.2 28025 56064 38131 36.0% 97.1%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.69 31.69 265.15 265.15 1.0045 1.6483 11679732.25 11679732.25 0.00 24909.69 366917.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.23 63.85% 36383.48 28291 40669 36383.46 34004 38629 736126 736126 0.00
crit 11.46 36.15% 72720.73 56583 81338 72719.15 66013 78685 833203 833203 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 169.6 63.96% 28025.39 34 31632 28025.64 26730 28735 4753118 4753118 0.00
crit 95.6 36.04% 56064.10 34 63263 56063.99 52868 58034 5357285 5357285 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2358 0.7% 25.5 17.47sec 41558 0 Periodic 75.5 14054 0 14054 0.0% 8.3%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.53 0.00 75.49 75.49 0.0000 0.4969 1060990.06 1559755.89 31.98 28284.77 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.5 100.00% 14053.85 27 15789 14057.23 13312 14741 1060990 1559756 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 12109 3.5% 24.8 16.53sec 217187 0 Direct 24.8 159731 319312 217205 36.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.76 24.76 0.00 0.00 0.0000 0.0000 5377968.24 7906122.73 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.85 63.99% 159731.11 124406 178834 159722.89 144493 171657 2531137 3721011 31.98
crit 8.92 36.01% 319311.68 248812 357668 319198.40 267473 357668 2846832 4185112 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 76703 22.6% 47.7 9.47sec 723938 720704 Direct 47.7 92739 185180 125872 35.8%  
Periodic 223.7 93567 187498 127433 36.1% 95.2%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.67 47.67 223.70 223.70 1.0045 1.9160 34508023.67 34508023.67 0.00 72422.97 720703.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.58 64.16% 92739.35 43376 207570 92762.80 80713 109177 2836083 2836083 0.00
crit 17.09 35.84% 185180.41 86751 415140 185238.58 148622 247627 3164195 3164195 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.0 63.95% 93567.24 40 207570 93600.33 83225 102729 13384839 13384839 0.00
crit 80.7 36.05% 187498.29 81 415140 187516.48 156503 212097 15122907 15122907 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 92161 27.2% 23.1 15.26sec 1793414 1785422 Periodic 327.7 93018 185958 126585 36.1% 96.6%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.13 0.00 327.73 327.73 1.0045 1.3266 41486069.61 41486069.61 0.00 90579.16 1785422.17
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 209.4 63.88% 93018.19 144 106835 93007.90 85535 97134 19474307 19474307 0.00
crit 118.4 36.12% 185958.00 144 213669 185940.14 168610 195208 22011763 22011763 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 32911 9.7% 113.9 3.94sec 129868 129287 Direct 113.9 95345 190794 129866 36.2%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.92 113.92 0.00 0.00 1.0045 0.0000 14794142.96 21748791.49 31.98 129286.66 129286.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.71 63.83% 95344.83 66596 143597 95358.48 89579 101975 6932833 10191921 31.98
crit 41.20 36.17% 190794.37 133191 287194 190753.93 173789 211517 7861310 11556871 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
instinct_880 / arcanocrystal_860
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_880 / arcanocrystal_860
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.08sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_880 / arcanocrystal_860
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_880 / arcanocrystal_860
  • harmful:false
  • if_expr:
 
Healing Touch 52.2 8.73sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 52.18 0.00 0.00 0.00 0.8357 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.8 24.33sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.83 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.17sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.35sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.19 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.09% 10.17% 45.4(45.4) 15.1

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.1sec 182.1sec 9.78% 14.50% 0.0(0.0) 2.9

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Blood Frenzy 14.7 7.9 30.6sec 19.5sec 40.38% 40.44% 7.9(7.9) 14.2

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:40.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 7.47% 0.0(0.0) 1.0

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 52.1 0.0 8.7sec 8.7sec 46.26% 46.30% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.55%
  • bloodtalons_2:27.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 45.4 1.6 9.8sec 9.4sec 6.76% 15.42% 1.6(1.6) 0.0

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.76%

Trigger Attempt Success

  • trigger_pct:8.76%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.9 64.3sec 48.5sec 24.72% 24.81% 1.9(1.9) 6.4

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.1sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 51.9 1.1 8.6sec 8.5sec 74.38% 74.39% 1.1(1.1) 0.0

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.38%

Trigger Attempt Success

  • trigger_pct:98.81%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 7.4 11.4 51.9sec 24.4sec 94.41% 94.15% 202.5(202.5) 6.4

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:94.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 132.9sec 132.9sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.77% 28.93% 0.0(0.0) 14.9

Buff details

  • buff initial source:instinct_880 / arcanocrystal_860
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
instinct_880 / arcanocrystal_860
ferocious_bite Energy 23.3 404.3 17.3 34.7 9092.8
ferocious_bite Combo Points 11.7 55.1 4.7 4.7 66740.8
lunar_inspiration Energy 31.7 786.9 24.8 24.8 14842.0
rake Energy 47.7 1358.9 28.5 28.5 25393.4
rip Energy 23.1 466.6 20.2 20.2 88913.6
rip Combo Points 23.1 115.7 5.0 5.0 358685.3
savage_roar Energy 18.8 483.4 25.7 25.7 0.0
savage_roar Combo Points 18.8 94.2 5.0 5.0 0.0
shred Energy 113.9 3392.6 29.8 29.8 4360.7
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.67 47.67 (17.78%) 1.00 0.00 0.00%
tigers_fury Energy 15.19 910.75 (10.83%) 59.96 0.59 0.06%
ashamanes_frenzy Combo Points 6.13 18.39 (6.86%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.69 31.69 (11.82%) 1.00 0.00 0.00%
shred Combo Points 113.91 113.91 (42.48%) 1.00 0.00 0.00%
energy_regen Energy 2042.31 5290.92 (62.93%) 2.59 86.51 1.61%
clearcasting Energy 45.32 1547.24 (18.40%) 34.14 0.00 0.00%
ashamanes_energy Energy 45.35 658.56 (7.83%) 14.52 21.72 3.19%
primal_fury Combo Points 69.74 56.50 (21.07%) 0.81 13.24 18.98%
Resource RPS-Gain RPS-Loss
Energy 15.25 15.32
Combo Points 0.60 0.59
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 38.77 0.06 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.33 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.0%

Procs

Count Interval
clearcasting 47.0 9.4sec
clearcasting_wasted 1.6 112.2sec
primal_fury 69.7 6.4sec

Statistics & Data Analysis

Fight Length
Sample Data instinct_880 / arcanocrystal_860 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data instinct_880 / arcanocrystal_860 Damage Per Second
Count 2499
Mean 339751.06
Minimum 301471.02
Maximum 374467.25
Spread ( max - min ) 72996.23
Range [ ( max - min ) / 2 * 100% ] 10.74%
Standard Deviation 10870.9198
5th Percentile 322415.82
95th Percentile 357849.18
( 95th Percentile - 5th Percentile ) 35433.37
Mean Distribution
Standard Deviation 217.4619
95.00% Confidence Intervall ( 339324.84 - 340177.27 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3932
0.1 Scale Factor Error with Delta=300 1008825
0.05 Scale Factor Error with Delta=300 4035303
0.01 Scale Factor Error with Delta=300 100882596
Priority Target DPS
Sample Data instinct_880 / arcanocrystal_860 Priority Target Damage Per Second
Count 2499
Mean 339751.06
Minimum 301471.02
Maximum 374467.25
Spread ( max - min ) 72996.23
Range [ ( max - min ) / 2 * 100% ] 10.74%
Standard Deviation 10870.9198
5th Percentile 322415.82
95th Percentile 357849.18
( 95th Percentile - 5th Percentile ) 35433.37
Mean Distribution
Standard Deviation 217.4619
95.00% Confidence Intervall ( 339324.84 - 340177.27 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3932
0.1 Scale Factor Error with Delta=300 1008825
0.05 Scale Factor Error with Delta=300 4035303
0.01 Scale Factor Error with Delta=300 100882596
DPS(e)
Sample Data instinct_880 / arcanocrystal_860 Damage Per Second (Effective)
Count 2499
Mean 339751.06
Minimum 301471.02
Maximum 374467.25
Spread ( max - min ) 72996.23
Range [ ( max - min ) / 2 * 100% ] 10.74%
Damage
Sample Data instinct_880 / arcanocrystal_860 Damage
Count 2499
Mean 152795487.47
Minimum 110493951.02
Maximum 191042714.86
Spread ( max - min ) 80548763.84
Range [ ( max - min ) / 2 * 100% ] 26.36%
DTPS
Sample Data instinct_880 / arcanocrystal_860 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data instinct_880 / arcanocrystal_860 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data instinct_880 / arcanocrystal_860 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data instinct_880 / arcanocrystal_860 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data instinct_880 / arcanocrystal_860 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data instinct_880 / arcanocrystal_860 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data instinct_880 / arcanocrystal_860Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data instinct_880 / arcanocrystal_860 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.57 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.57 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.19 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 3.59 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 51.18 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 7.44 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 23.13 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 11.39 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 8.07 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.13 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.57 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 43.09 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.69 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 113.91 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQIQQEMJQQOCAPEJN89QQQEKQQQQELPQOQEJOQQQELOPCQEJQQQQEKOQPQQEJOQPEOCJQQQQQEIMOPEJOQPEOCQJQQQEIOPOEQQJPQQQCEJOQQQEIOPOEJOPQEKMOCQEJN89QPELQQQOPEJOQQQCAEIOPQQQEJOQQQELQQPQEJOQQQEIOQCPQQEJOQQQEKMOPEJOQQQECJOPQQEKOQQPEJOQQQEKCOPQEJOQQQEJOPQQEKOCN89PQEJMQQEKOPQQEJOQPQCEJOQQQEKOPQQEDOQPQQECABKOQQQDQQQPELOQQQELOPEMKOCQQQELOPQQQEKOQQEDOPQQCELN89QQEKPQ

Sample Sequence Table

time name target resources buffs
Pre flask instinct_880 / arcanocrystal_860 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food instinct_880 / arcanocrystal_860 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation instinct_880 / arcanocrystal_860 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, blood_frenzy, potion_of_the_old_war
0:01.004 lunar_inspiration Fluffy_Pillow 78.3/100: 78% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, blood_frenzy, potion_of_the_old_war
0:02.008 shred Fluffy_Pillow 64.6/100: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, bloodtalons, blood_frenzy, potion_of_the_old_war
0:03.013 savage_roar Fluffy_Pillow 80.9/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, blood_frenzy, potion_of_the_old_war
0:04.017 shred Fluffy_Pillow 57.2/100: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:05.021 shred Fluffy_Pillow 73.5/100: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:06.025 healing_touch Fluffy_Pillow 49.8/100: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:06.780 ashamanes_frenzy Fluffy_Pillow 62.1/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, blood_frenzy, potion_of_the_old_war
0:07.784 rip Fluffy_Pillow 78.4/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons, savage_roar, blood_frenzy, potion_of_the_old_war
0:08.789 shred Fluffy_Pillow 94.7/100: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:09.795 shred Fluffy_Pillow 71.0/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:10.801 rake Fluffy_Pillow 45.9/100: 46% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:11.807 tigers_fury Fluffy_Pillow 25.4/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:11.807 berserk Fluffy_Pillow 85.4/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:11.807 lunar_inspiration Fluffy_Pillow 85.4/150: 57% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:12.813 healing_touch Fluffy_Pillow 99.9/150: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:13.569 rip Fluffy_Pillow 110.7/150: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:14.574 shadowmeld Fluffy_Pillow 140.2/150: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:14.574 rake Fluffy_Pillow 140.2/150: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:14.574 auto_attack Fluffy_Pillow 122.7/150: 82% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:15.578 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:16.583 shred Fluffy_Pillow 144.5/150: 96% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:17.589 shred Fluffy_Pillow 138.9/150: 93% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:18.592 healing_touch Fluffy_Pillow 133.4/150: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:19.349 savage_roar Fluffy_Pillow 144.3/150: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:20.353 shred Fluffy_Pillow 138.7/150: 92% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:21.357 shred Fluffy_Pillow 133.2/150: 89% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.362 shred Fluffy_Pillow 127.7/150: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.367 shred Fluffy_Pillow 122.1/150: 81% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar
0:24.372 healing_touch Fluffy_Pillow 116.6/150: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar
0:25.127 ferocious_bite Fluffy_Pillow 127.5/150: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar
0:26.132 lunar_inspiration Fluffy_Pillow 116.9/150: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar
0:27.137 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:28.142 rake Fluffy_Pillow 76.3/100: 76% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy
0:29.146 shred Fluffy_Pillow 57.6/100: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy
0:30.150 healing_touch Fluffy_Pillow 33.9/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, blood_frenzy
0:30.905 rip Fluffy_Pillow 46.2/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, blood_frenzy
0:31.909 rake Fluffy_Pillow 62.5/100: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:32.912 shred Fluffy_Pillow 78.8/100: 79% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, blood_frenzy
0:33.917 shred Fluffy_Pillow 95.1/100: 95% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy
0:34.921 shred Fluffy_Pillow 71.4/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy
0:35.927 healing_touch Fluffy_Pillow 47.7/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy
0:36.719 Waiting 1.800 sec 59.9/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:38.519 ferocious_bite Fluffy_Pillow 85.9/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:39.525 rake Fluffy_Pillow 50.3/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:40.529 Waiting 0.100 sec 29.8/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:40.629 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:41.633 tigers_fury Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:41.807 shred Fluffy_Pillow 74.3/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:42.812 healing_touch Fluffy_Pillow 60.4/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:43.720 Waiting 0.400 sec 70.5/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:44.120 rip Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:45.123 shred Fluffy_Pillow 86.0/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:46.127 shred Fluffy_Pillow 57.1/100: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
0:47.132 shred Fluffy_Pillow 68.2/100: 68% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
0:48.135 Waiting 0.100 sec 39.3/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
0:48.235 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
0:49.241 healing_touch Fluffy_Pillow 13.0/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:50.045 savage_roar Fluffy_Pillow 23.1/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
0:51.051 rake Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
0:52.055 shred Fluffy_Pillow 48.2/100: 48% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:53.059 Waiting 0.844 sec 20.7/100: 21% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:53.903 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:54.906 shred Fluffy_Pillow 13.8/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
0:55.911 Waiting 1.100 sec 26.3/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:57.011 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:58.018 healing_touch Fluffy_Pillow 12.6/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
0:58.899 rip Fluffy_Pillow 22.7/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:00.159 rake Fluffy_Pillow 36.7/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:01.164 Waiting 2.503 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:03.667 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:04.671 Waiting 2.208 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:06.879 lunar_inspiration Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:07.882 Waiting 1.606 sec 17.2/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:09.488 healing_touch Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:10.397 rake Fluffy_Pillow 45.0/100: 45% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar
1:11.400 Waiting 0.349 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
1:11.749 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
1:11.807 Waiting 0.300 sec 85.6/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
1:12.107 rip Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
1:13.111 shred Fluffy_Pillow 85.1/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:14.115 shred Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:15.118 shred Fluffy_Pillow 57.3/100: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, tigers_fury
1:16.125 shred Fluffy_Pillow 68.4/100: 68% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
1:17.130 Waiting 0.100 sec 39.6/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
1:17.230 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
1:18.233 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
1:20.927 savage_roar Fluffy_Pillow 41.6/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
1:21.931 ashamanes_frenzy Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:23.954 rake Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
1:24.959 Waiting 1.739 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:26.698 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:27.701 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:28.609 Waiting 0.399 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:29.008 rip Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:30.013 rake Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:31.017 Waiting 2.451 sec 13.4/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:33.468 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:34.471 Waiting 2.110 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:36.581 lunar_inspiration Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:37.587 Waiting 2.009 sec 16.1/100: 16% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:39.596 healing_touch Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:40.401 rake Fluffy_Pillow 51.3/100: 51% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:41.407 Waiting 0.200 sec 28.8/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar, blood_frenzy
1:41.607 tigers_fury Fluffy_Pillow 31.3/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar, blood_frenzy
1:41.807 shred Fluffy_Pillow 93.8/100: 94% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
1:42.811 Waiting 0.500 sec 81.4/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
1:43.311 rip Fluffy_Pillow 87.6/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
1:44.316 shred Fluffy_Pillow 85.2/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:45.322 shred Fluffy_Pillow 72.7/100: 73% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury, blood_frenzy
1:46.327 shred Fluffy_Pillow 45.3/100: 45% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury, blood_frenzy
1:47.331 healing_touch Fluffy_Pillow 17.8/100: 18% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, blood_frenzy
1:49.487 savage_roar Fluffy_Pillow 42.0/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
1:52.537 rake Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:53.540 Waiting 1.681 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:55.221 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:58.263 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
1:59.266 Waiting 0.922 sec 13.5/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:00.188 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
2:00.992 shred Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
2:01.997 shred Fluffy_Pillow 47.6/100: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar, blood_frenzy
2:03.002 Waiting 1.289 sec 20.1/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points savage_roar, blood_frenzy
2:04.291 rip Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points savage_roar, blood_frenzy
2:05.295 Waiting 0.598 sec 18.8/100: 19% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:05.893 lunar_inspiration Fluffy_Pillow 26.2/100: 26% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
2:06.897 shred Fluffy_Pillow 38.8/100: 39% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
2:07.902 shred Fluffy_Pillow 50.1/100: 50% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:08.906 Waiting 1.739 sec 21.2/100: 21% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:10.645 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:11.650 tigers_fury Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:11.807 healing_touch Fluffy_Pillow 73.4/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:12.714 rip Fluffy_Pillow 83.4/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
2:13.719 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, tigers_fury, jacins_ruse
2:14.723 shred Fluffy_Pillow 91.1/100: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, jacins_ruse
2:15.728 shred Fluffy_Pillow 77.4/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury, blood_frenzy, jacins_ruse
2:16.733 shred Fluffy_Pillow 49.9/100: 50% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury, blood_frenzy, jacins_ruse
2:17.738 healing_touch Fluffy_Pillow 22.5/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, blood_frenzy, jacins_ruse
2:19.308 savage_roar Fluffy_Pillow 42.1/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, blood_frenzy, jacins_ruse
2:22.098 rake Fluffy_Pillow 37.0/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:23.102 Waiting 1.340 sec 14.5/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:24.442 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:25.445 Waiting 1.399 sec 13.8/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:27.352 rake Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:28.358 healing_touch Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:29.265 Waiting 3.633 sec 21.3/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:32.898 rip Fluffy_Pillow 61.5/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:33.902 rake Fluffy_Pillow 72.7/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:34.906 lunar_inspiration Fluffy_Pillow 48.8/100: 49% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:35.910 Waiting 1.000 sec 29.9/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:36.910 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:37.915 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:38.824 Waiting 1.656 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:40.480 savage_roar Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:41.484 ashamanes_frenzy Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
2:42.489 rake Fluffy_Pillow 22.7/100: 23% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
2:43.493 tigers_fury Fluffy_Pillow 33.9/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:43.493 shred Fluffy_Pillow 93.9/100: 94% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:44.497 healing_touch Fluffy_Pillow 80.0/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:45.404 rip Fluffy_Pillow 90.0/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:46.408 shadowmeld Fluffy_Pillow 86.1/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:46.408 rake Fluffy_Pillow 86.1/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:46.408 auto_attack Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:47.412 shred Fluffy_Pillow 77.3/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
2:48.418 lunar_inspiration Fluffy_Pillow 48.4/100: 48% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
2:49.422 healing_touch Fluffy_Pillow 29.5/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
2:50.329 Waiting 4.500 sec 39.6/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
2:54.829 ferocious_bite Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:55.833 shred Fluffy_Pillow 75.5/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:56.837 shred Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:57.839 shred Fluffy_Pillow 17.7/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
2:58.845 Waiting 0.700 sec 28.9/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:59.545 rake Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:00.550 Waiting 1.707 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:02.257 lunar_inspiration Fluffy_Pillow 31.6/100: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:03.262 healing_touch Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:04.170 Waiting 1.696 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:05.866 rip Fluffy_Pillow 43.6/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
3:07.635 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, blood_frenzy
3:08.641 shred Fluffy_Pillow 13.2/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, blood_frenzy
3:09.645 Waiting 1.200 sec 25.8/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, blood_frenzy
3:10.845 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, blood_frenzy
3:11.851 Waiting 0.934 sec 13.3/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, blood_frenzy
3:12.785 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, blood_frenzy
3:13.790 tigers_fury Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, blood_frenzy
3:13.790 berserk Fluffy_Pillow 97.6/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, blood_frenzy
3:13.790 healing_touch Fluffy_Pillow 97.6/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, tigers_fury, blood_frenzy
3:14.612 savage_roar Fluffy_Pillow 107.6/150: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, tigers_fury
3:15.617 rake Fluffy_Pillow 113.7/150: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:16.621 lunar_inspiration Fluffy_Pillow 122.4/150: 82% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:17.626 shred Fluffy_Pillow 133.5/150: 89% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury
3:18.631 shred Fluffy_Pillow 124.6/150: 83% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:19.636 shred Fluffy_Pillow 115.7/150: 77% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:20.641 healing_touch Fluffy_Pillow 106.9/150: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:21.546 rip Fluffy_Pillow 116.9/150: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury
3:22.551 rake Fluffy_Pillow 113.0/150: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:23.554 shred Fluffy_Pillow 106.6/150: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar
3:24.559 shred Fluffy_Pillow 97.8/150: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar
3:25.563 shred Fluffy_Pillow 88.9/150: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar
3:26.568 healing_touch Fluffy_Pillow 80.0/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:27.475 ferocious_bite Fluffy_Pillow 90.0/150: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:28.478 shred Fluffy_Pillow 76.2/150: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:29.483 shred Fluffy_Pillow 67.3/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:30.489 lunar_inspiration Fluffy_Pillow 38.4/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:31.493 shred Fluffy_Pillow 19.5/100: 20% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
3:32.497 healing_touch Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
3:33.404 rip Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:34.408 rake Fluffy_Pillow 51.8/100: 52% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:35.414 Waiting 0.300 sec 28.0/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:35.714 shred Fluffy_Pillow 31.3/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
3:36.718 shred Fluffy_Pillow 42.6/100: 43% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:37.723 Waiting 1.290 sec 15.1/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:39.013 shred Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, blood_frenzy
3:40.017 healing_touch Fluffy_Pillow 43.8/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, blood_frenzy
3:40.821 savage_roar Fluffy_Pillow 53.8/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), blood_frenzy
3:42.339 rake Fluffy_Pillow 32.8/100: 33% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
3:43.344 shred Fluffy_Pillow 45.3/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
3:44.345 tigers_fury Fluffy_Pillow 17.8/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:44.345 lunar_inspiration Fluffy_Pillow 77.8/100: 78% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:45.351 shred Fluffy_Pillow 75.4/100: 75% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:46.354 shred Fluffy_Pillow 62.9/100: 63% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:47.360 healing_touch Fluffy_Pillow 49.4/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
3:48.268 Waiting 0.700 sec 59.5/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
3:48.968 rip Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
3:49.973 rake Fluffy_Pillow 78.3/100: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
3:50.977 shred Fluffy_Pillow 54.5/100: 54% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
3:51.981 Waiting 0.500 sec 25.6/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
3:52.481 shred Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
3:53.486 shred Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:54.489 healing_touch Fluffy_Pillow 13.3/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:55.395 Waiting 5.946 sec 23.4/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:01.341 savage_roar Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:02.345 ashamanes_frenzy Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:03.349 rake Fluffy_Pillow 72.9/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:04.352 lunar_inspiration Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
4:05.357 healing_touch Fluffy_Pillow 63.0/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:06.161 Waiting 1.200 sec 73.0/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
4:07.361 rip Fluffy_Pillow 88.0/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
4:08.366 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:09.370 shred Fluffy_Pillow 77.5/100: 78% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:10.374 shred Fluffy_Pillow 50.1/100: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:11.379 Waiting 1.489 sec 22.6/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:12.868 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:13.873 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:14.781 tigers_fury Fluffy_Pillow 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:14.781 Waiting 0.700 sec 81.7/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
4:15.481 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
4:16.484 rake Fluffy_Pillow 85.5/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:17.488 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:18.493 shred Fluffy_Pillow 96.1/100: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:19.499 shred Fluffy_Pillow 67.3/100: 67% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:20.503 healing_touch Fluffy_Pillow 38.4/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:21.358 Waiting 3.200 sec 48.4/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:24.558 savage_roar Fluffy_Pillow 88.4/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
4:25.563 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:26.568 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:27.572 shred Fluffy_Pillow 72.5/100: 73% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:28.576 lunar_inspiration Fluffy_Pillow 45.1/100: 45% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:29.579 healing_touch Fluffy_Pillow 27.6/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:30.382 Waiting 4.000 sec 37.6/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
4:34.382 rip Fluffy_Pillow 82.8/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:35.387 rake Fluffy_Pillow 93.9/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:36.390 shred Fluffy_Pillow 70.0/100: 70% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:37.393 shred Fluffy_Pillow 42.5/100: 43% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:38.397 Waiting 2.095 sec 15.1/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:40.492 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:41.498 healing_touch Fluffy_Pillow 13.8/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:42.301 Waiting 1.300 sec 23.8/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
4:43.601 savage_roar Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
4:44.607 tigers_fury Fluffy_Pillow 12.6/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
4:44.781 rake Fluffy_Pillow 74.8/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:45.788 lunar_inspiration Fluffy_Pillow 67.4/100: 67% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:46.795 shred Fluffy_Pillow 64.9/100: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:47.799 healing_touch Fluffy_Pillow 52.5/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:48.631 Waiting 2.300 sec 62.5/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:50.931 rip Fluffy_Pillow 88.4/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
4:51.934 rake Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:52.937 shred Fluffy_Pillow 48.5/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:53.941 shred Fluffy_Pillow 21.0/100: 21% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
4:54.946 Waiting 0.600 sec 33.6/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:55.546 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:56.552 healing_touch Fluffy_Pillow 13.6/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:57.358 Waiting 5.505 sec 23.7/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:02.863 rip Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:03.868 rake Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:04.872 lunar_inspiration Fluffy_Pillow 81.5/100: 82% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:05.876 shred Fluffy_Pillow 62.7/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:06.882 Waiting 0.600 sec 33.8/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:07.482 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:08.484 healing_touch Fluffy_Pillow 11.5/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:09.391 Waiting 2.409 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:11.800 savage_roar Fluffy_Pillow 48.3/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:14.336 rake Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:15.340 tigers_fury Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:15.340 shadowmeld Fluffy_Pillow 72.4/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:15.340 rake Fluffy_Pillow 72.4/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:15.340 auto_attack Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:16.344 lunar_inspiration Fluffy_Pillow 63.6/100: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:17.349 shred Fluffy_Pillow 59.7/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:18.354 healing_touch Fluffy_Pillow 45.8/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:19.260 Waiting 3.000 sec 55.9/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:22.260 rip Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:23.265 ashamanes_frenzy Fluffy_Pillow 70.2/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:24.271 shred Fluffy_Pillow 81.3/100: 81% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:25.275 shred Fluffy_Pillow 52.5/100: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:26.278 healing_touch Fluffy_Pillow 63.6/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:27.186 Waiting 1.200 sec 73.6/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:28.386 savage_roar Fluffy_Pillow 86.9/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:29.391 rake Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:30.396 lunar_inspiration Fluffy_Pillow 34.2/100: 34% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:31.400 shred Fluffy_Pillow 45.3/100: 45% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:32.405 Waiting 2.175 sec 16.4/100: 16% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:34.580 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:35.584 healing_touch Fluffy_Pillow 13.4/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:36.389 rip Fluffy_Pillow 23.5/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
5:37.393 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:38.398 Waiting 2.214 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:40.612 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:41.616 Waiting 1.399 sec 13.8/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:43.015 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:44.019 Waiting 0.898 sec 13.8/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:44.917 shred Fluffy_Pillow 24.1/100: 24% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:45.921 tigers_fury Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:45.921 healing_touch Fluffy_Pillow 95.2/100: 95% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:46.828 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:47.833 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:48.836 shred Fluffy_Pillow 91.1/100: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:49.841 shred Fluffy_Pillow 77.2/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
5:50.847 shred Fluffy_Pillow 48.4/100: 48% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
5:51.852 healing_touch Fluffy_Pillow 59.5/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:52.757 Waiting 1.800 sec 69.5/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:54.557 savage_roar Fluffy_Pillow 89.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:55.562 rake Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:56.566 Waiting 0.200 sec 36.7/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:56.766 lunar_inspiration Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:57.772 Waiting 1.846 sec 20.1/100: 20% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
5:59.618 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
6:00.623 Waiting 1.207 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:01.830 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
6:02.835 healing_touch Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:03.743 Waiting 1.000 sec 46.2/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:04.743 ferocious_bite Fluffy_Pillow 57.2/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:07.284 rake Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:08.287 shred Fluffy_Pillow 11.5/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
6:09.291 Waiting 1.415 sec 22.6/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:10.706 lunar_inspiration Fluffy_Pillow 38.3/100: 38% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:11.711 Waiting 1.905 sec 19.4/100: 19% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:13.616 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:14.620 shred Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
6:15.626 healing_touch Fluffy_Pillow 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:16.513 tigers_fury Fluffy_Pillow 32.8/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
6:16.513 berserk Fluffy_Pillow 92.8/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
6:16.513 potion Fluffy_Pillow 92.8/150: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, blood_frenzy
6:16.513 savage_roar Fluffy_Pillow 92.8/150: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:17.517 rake Fluffy_Pillow 100.3/150: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:18.521 shred Fluffy_Pillow 110.4/150: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:19.525 shred Fluffy_Pillow 117.9/150: 79% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:20.529 shred Fluffy_Pillow 130.5/150: 87% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:21.534 ferocious_bite Fluffy_Pillow 123.0/150: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:22.540 shred Fluffy_Pillow 110.6/150: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:23.545 shred Fluffy_Pillow 103.1/150: 69% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:24.549 shred Fluffy_Pillow 95.7/150: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:25.554 lunar_inspiration Fluffy_Pillow 88.2/150: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:26.560 healing_touch Fluffy_Pillow 85.5/150: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:27.466 ferocious_bite Fluffy_Pillow 95.5/150: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
6:28.470 rake Fluffy_Pillow 81.6/150: 54% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:29.473 shred Fluffy_Pillow 75.3/150: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:30.478 shred Fluffy_Pillow 66.4/150: 44% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:31.484 shred Fluffy_Pillow 57.5/150: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:32.486 healing_touch Fluffy_Pillow 48.6/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:33.395 Waiting 2.800 sec 58.7/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse, potion_of_the_old_war
6:36.195 ferocious_bite Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse, potion_of_the_old_war
6:37.202 rake Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:38.207 Waiting 0.500 sec 27.0/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:38.707 lunar_inspiration Fluffy_Pillow 32.5/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:39.713 healing_touch Fluffy_Pillow 13.6/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:40.621 ashamanes_frenzy Fluffy_Pillow 23.7/100: 24% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:41.625 Waiting 1.900 sec 34.8/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
6:43.525 savage_roar Fluffy_Pillow 55.9/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
6:45.298 rake Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
6:46.304 tigers_fury Fluffy_Pillow 14.9/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:46.513 shred Fluffy_Pillow 77.6/100: 78% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:47.516 shred Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:48.520 shred Fluffy_Pillow 52.6/100: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:49.523 healing_touch Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:50.327 Waiting 3.000 sec 50.2/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
6:53.327 ferocious_bite Fluffy_Pillow 87.7/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
6:54.331 rake Fluffy_Pillow 74.7/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
6:55.333 lunar_inspiration Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
6:56.338 shred Fluffy_Pillow 61.9/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:57.343 shred Fluffy_Pillow 33.0/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
6:58.348 shred Fluffy_Pillow 44.2/100: 44% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:59.354 healing_touch Fluffy_Pillow 15.3/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:00.212 Waiting 1.900 sec 25.3/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
7:02.112 savage_roar Fluffy_Pillow 49.1/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
7:03.118 rake Fluffy_Pillow 61.6/100: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
7:04.123 shred Fluffy_Pillow 74.2/100: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
7:05.128 shred Fluffy_Pillow 46.7/100: 47% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:06.132 healing_touch Fluffy_Pillow 19.3/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:06.938 Waiting 3.300 sec 29.3/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
7:10.238 ferocious_bite Fluffy_Pillow 70.0/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
7:11.242 rake Fluffy_Pillow 56.1/100: 56% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
7:12.247 lunar_inspiration Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:13.251 shred Fluffy_Pillow 48.4/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:14.257 Waiting 1.699 sec 20.0/100: 20% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:15.956 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:16.962 tigers_fury Fluffy_Pillow 13.8/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:16.962 healing_touch Fluffy_Pillow 73.8/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:17.766 Waiting 0.200 sec 83.8/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
7:17.966 ferocious_bite Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
7:18.969 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:18.969 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:18.969 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:19.973 shred Fluffy_Pillow 92.5/100: 93% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:20.978 shred Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:21.983 healing_touch Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:22.787 Waiting 3.600 sec 47.7/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
7:26.387 savage_roar Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:27.390 lunar_inspiration Fluffy_Pillow 60.2/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:28.395 shred Fluffy_Pillow 41.4/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:29.400 Waiting 1.130 sec 12.5/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 23361 21655 11591 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 28033 25986 0
Crit 36.08% 36.08% 7027
Haste 10.73% 10.73% 3488
Damage / Heal Versatility 7.65% 7.65% 3058
Attack Power 23361 21655 0
Mastery 56.30% 54.16% 6678
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 848.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="instinct_880 / arcanocrystal_860"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=unstable_arcanocrystal,id=141482
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=847.50
# gear_agility=11591
# gear_stamina=17628
# gear_crit_rating=7027
# gear_haste_rating=2325
# gear_mastery_rating=6678
# gear_versatility_rating=3058
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

instinct_880 / call_880 : 329082 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
329081.9 329081.9 427.8 / 0.130% 42189.4 / 12.8% 21580.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.2 15.2 Energy 30.05% 44.0 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
instinct_880 / call_880 329082
Ashamane's Frenzy 15625 4.7% 6.1 78.45sec 1149632 1144621 Direct 91.5 10518 21051 14279 35.7%  
Periodic 30.2 139157 278329 189121 35.9% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.11 91.48 121.72 30.24 1.0045 0.6472 7025684.06 7639735.18 8.04 82736.87 1144621.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.81 64.29% 10517.59 7740 13558 10521.62 9158 11780 618533 909303 31.98
crit 32.67 35.71% 21051.10 15480 27116 21058.49 18577 24477 687695 1010977 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.4 64.09% 139156.84 85342 186856 139229.71 123255 156325 2697304 2697304 0.00
crit 10.9 35.91% 278328.68 170684 373712 278373.90 230920 343362 3022151 3022151 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 40036 12.2% 19.1 22.29sec 945774 0 Periodic 150.8 88160 176324 119514 35.6% 43.3%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.06 0.00 150.84 150.84 0.0000 1.2910 18027233.83 18027233.83 0.00 92573.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.2 64.44% 88159.93 60 113186 88051.81 79441 96375 8568677 8568677 0.00
crit 53.6 35.56% 176323.98 139 226371 176165.49 148995 195337 9458557 9458557 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 30884 9.4% 532.5 0.84sec 26090 31013 Direct 532.5 19261 38520 26090 35.5%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 532.47 532.47 0.00 0.00 0.8412 0.0000 13891962.39 20422500.59 31.98 31013.14 31013.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 343.67 64.54% 19260.66 14990 21547 19260.39 18836 19569 6619281 9730970 31.98
crit 188.80 35.46% 38520.25 29979 43095 38519.39 37541 39292 7272681 10691530 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 7694 2.3% 11.4 40.87sec 303848 302507 Direct 11.4 212516 468596 303864 35.7%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.38 11.38 0.00 0.00 1.0045 0.0000 3457350.31 5082632.44 31.98 302506.81 302506.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.32 64.32% 212515.95 16393 271087 212260.03 116747 264015 1555328 2286480 31.98
crit 4.06 35.68% 468596.43 35172 599103 464234.65 0 599103 1902022 2796152 31.70
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 25190 7.7% 31.7 14.30sec 357750 356154 Direct 31.7 35698 71367 48388 35.6%  
Periodic 263.2 27491 54983 37228 35.4% 97.1%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.68 31.68 263.21 263.21 1.0045 1.6599 11331749.39 11331749.39 0.00 24175.33 356153.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.41 64.43% 35697.82 27761 39907 35698.55 33367 37593 728525 728525 0.00
crit 11.27 35.57% 71366.76 55522 79813 71382.34 64198 77211 804092 804092 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 170.0 64.58% 27491.41 15 31039 27491.97 26734 28163 4673209 4673209 0.00
crit 93.2 35.42% 54982.57 29 62078 54982.39 50855 56937 5125923 5125923 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2293 0.7% 25.3 17.69sec 40743 0 Periodic 74.8 13785 0 13785 0.0% 8.3%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.31 0.00 74.80 74.80 0.0000 0.4969 1031088.36 1515797.56 31.98 27742.04 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.8 100.00% 13785.02 27 15493 13786.21 12954 14454 1031088 1515798 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11865 3.6% 24.8 16.58sec 212486 0 Direct 24.8 156634 313277 212487 35.7%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.79 24.79 0.00 0.00 0.0000 0.0000 5267341.34 7743490.70 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.95 64.34% 156633.53 122075 175482 156622.83 142420 167852 2498345 3672804 31.98
crit 8.84 35.66% 313276.89 244149 350964 313258.48 274668 350964 2768996 4070687 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 74245 22.6% 47.5 9.49sec 703139 699995 Direct 47.5 90227 180435 122226 35.5%  
Periodic 223.7 91073 182200 123367 35.4% 95.2%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.51 47.51 223.69 223.69 1.0045 1.9142 33403739.35 33403739.35 0.00 70188.75 699994.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.66 64.53% 90227.36 41849 219909 90248.91 77143 101888 2766059 2766059 0.00
crit 16.85 35.47% 180435.20 83698 439818 180426.13 136120 237488 3040364 3040364 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 144.4 64.56% 91072.64 39 219909 91085.93 80957 99489 13151314 13151314 0.00
crit 79.3 35.44% 182200.36 78 439818 182237.71 154339 206650 14446003 14446003 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 89301 27.2% 23.1 15.24sec 1739559 1731813 Periodic 327.5 90545 181131 122725 35.5% 96.5%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.11 0.00 327.53 327.53 1.0045 1.3262 40197115.70 40197115.70 0.00 87844.69 1731813.18
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 211.2 64.48% 90545.41 60 113186 90539.34 84835 94774 19121633 19121633 0.00
crit 116.4 35.52% 181130.99 307 226371 181118.00 167624 189923 21075483 21075483 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 31950 9.7% 113.3 3.96sec 126752 126185 Direct 113.3 93481 187074 126745 35.5%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.29 113.29 0.00 0.00 1.0045 0.0000 14359115.48 21109259.89 31.98 126185.17 126185.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.02 64.45% 93481.02 65348 140906 93500.76 87501 99519 6825826 10034611 31.98
crit 40.27 35.55% 187074.21 130695 281811 187024.56 168838 208531 7533290 11074649 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
instinct_880 / call_880
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_880 / call_880
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.06sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Cleansed Drake's Breath 4.3 78.96sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.28 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_880 / call_880
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_880 / call_880
  • harmful:false
  • if_expr:
 
Healing Touch 51.8 8.78sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 51.76 0.00 0.00 0.00 0.8421 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.8 24.41sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.77 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.30sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.35sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.10% 10.18% 45.4(45.4) 15.1

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 14.58% 0.0(0.0) 2.9

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Blood Frenzy 14.7 8.0 30.7sec 19.4sec 40.49% 40.55% 8.0(8.0) 14.2

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:40.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 7.38% 0.0(0.0) 1.0

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 51.7 0.0 8.8sec 8.8sec 46.04% 46.08% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.48%
  • bloodtalons_2:27.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Cleansed Ancient's Blessing 3.9 0.3 86.9sec 78.4sec 8.92% 9.01% 0.3(0.3) 3.8

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_ancients_blessing_1:8.92%

Trigger Attempt Success

  • trigger_pct:98.76%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 4.0 0.3 87.1sec 78.8sec 9.17% 9.26% 0.3(0.3) 3.9

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_sisters_blessing_1:9.17%

Trigger Attempt Success

  • trigger_pct:98.62%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 3.9 0.3 87.7sec 79.0sec 9.02% 9.12% 0.3(0.3) 3.8

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_wisps_blessing_1:9.02%

Trigger Attempt Success

  • trigger_pct:98.80%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Clearcasting 45.0 1.6 9.8sec 9.5sec 6.70% 15.36% 1.6(1.6) 0.0

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.70%

Trigger Attempt Success

  • trigger_pct:8.74%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.8 63.8sec 48.4sec 24.62% 24.70% 1.8(1.8) 6.4

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.5sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 51.5 1.1 8.7sec 8.5sec 74.42% 74.44% 1.1(1.1) 0.0

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.42%

Trigger Attempt Success

  • trigger_pct:98.74%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 7.5 11.2 51.5sec 24.4sec 94.21% 93.92% 201.5(201.5) 6.5

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:94.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 132.9sec 132.9sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.78% 29.08% 0.0(0.0) 14.9

Buff details

  • buff initial source:instinct_880 / call_880
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
instinct_880 / call_880
ferocious_bite Energy 22.8 392.1 17.2 34.5 8817.9
ferocious_bite Combo Points 11.4 53.5 4.7 4.7 64611.8
lunar_inspiration Energy 31.7 782.3 24.7 24.7 14485.2
rake Energy 47.5 1353.1 28.5 28.5 24686.3
rip Energy 23.1 466.9 20.2 20.2 86086.9
rip Combo Points 23.1 115.5 5.0 5.0 347901.8
savage_roar Energy 18.8 480.6 25.6 25.6 0.0
savage_roar Combo Points 18.8 93.9 5.0 5.0 0.0
shred Energy 113.3 3382.7 29.9 29.9 4244.8
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.51 47.51 (17.85%) 1.00 0.00 0.00%
tigers_fury Energy 15.20 911.54 (10.91%) 59.97 0.50 0.05%
ashamanes_frenzy Combo Points 6.11 18.33 (6.89%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.68 31.68 (11.90%) 1.00 0.00 0.00%
shred Combo Points 113.29 113.29 (42.56%) 1.00 0.00 0.00%
energy_regen Energy 2039.05 5254.59 (62.87%) 2.58 82.01 1.54%
clearcasting Energy 44.88 1532.04 (18.33%) 34.14 0.00 0.00%
ashamanes_energy Energy 45.39 659.15 (7.89%) 14.52 21.72 3.19%
primal_fury Combo Points 68.38 55.37 (20.80%) 0.81 13.01 19.03%
Resource RPS-Gain RPS-Loss
Energy 15.17 15.24
Combo Points 0.59 0.58
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 38.42 0.01 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.16 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.9%

Procs

Count Interval
clearcasting 46.5 9.5sec
clearcasting_wasted 1.6 119.2sec
primal_fury 68.4 6.6sec

Statistics & Data Analysis

Fight Length
Sample Data instinct_880 / call_880 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data instinct_880 / call_880 Damage Per Second
Count 2499
Mean 329081.92
Minimum 296355.30
Maximum 370378.75
Spread ( max - min ) 74023.45
Range [ ( max - min ) / 2 * 100% ] 11.25%
Standard Deviation 10911.7370
5th Percentile 311184.58
95th Percentile 347251.78
( 95th Percentile - 5th Percentile ) 36067.21
Mean Distribution
Standard Deviation 218.2784
95.00% Confidence Intervall ( 328654.10 - 329509.74 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4223
0.1 Scale Factor Error with Delta=300 1016415
0.05 Scale Factor Error with Delta=300 4065663
0.01 Scale Factor Error with Delta=300 101641589
Priority Target DPS
Sample Data instinct_880 / call_880 Priority Target Damage Per Second
Count 2499
Mean 329081.92
Minimum 296355.30
Maximum 370378.75
Spread ( max - min ) 74023.45
Range [ ( max - min ) / 2 * 100% ] 11.25%
Standard Deviation 10911.7370
5th Percentile 311184.58
95th Percentile 347251.78
( 95th Percentile - 5th Percentile ) 36067.21
Mean Distribution
Standard Deviation 218.2784
95.00% Confidence Intervall ( 328654.10 - 329509.74 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4223
0.1 Scale Factor Error with Delta=300 1016415
0.05 Scale Factor Error with Delta=300 4065663
0.01 Scale Factor Error with Delta=300 101641589
DPS(e)
Sample Data instinct_880 / call_880 Damage Per Second (Effective)
Count 2499
Mean 329081.92
Minimum 296355.30
Maximum 370378.75
Spread ( max - min ) 74023.45
Range [ ( max - min ) / 2 * 100% ] 11.25%
Damage
Sample Data instinct_880 / call_880 Damage
Count 2499
Mean 147992380.20
Minimum 108456720.33
Maximum 186450216.68
Spread ( max - min ) 77993496.35
Range [ ( max - min ) / 2 * 100% ] 26.35%
DTPS
Sample Data instinct_880 / call_880 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data instinct_880 / call_880 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data instinct_880 / call_880 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data instinct_880 / call_880 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data instinct_880 / call_880 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data instinct_880 / call_880 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data instinct_880 / call_880Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data instinct_880 / call_880 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.57 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.57 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.20 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 3.70 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 50.76 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 7.53 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 23.11 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 11.25 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 7.68 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.11 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.57 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.93 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.68 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 113.29 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQCAQIQEMJQQOPELOQQEJQQQEKOPQQQCEJN89QQQPEKQQOEOJPQCQEJOQPEIOQQEJMOEKPOQECJQQQELOPQQEJOPQEKOCQQQEJOPQQEKOQQPEOJQQCQEJN89PQQEIMQQEJOPQEKOCAQPQEJOQQELQQQELOPQEJOQQQCPEIOQQEJOPQEOQJPECOQIQQQPEJMOQEJOPQCQEIN89QQQEJPQQOEOIPOCQEJQQQPEJOQQQQEIOPOCEJMQQEKOPQDQEOQPLQQCABQOEKQOPQELQQQQQELOPQQEKOQCQQEDN89PQQEKMDOPEOCQLQQPEKOQQED

Sample Sequence Table

time name target resources buffs
Pre flask instinct_880 / call_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food instinct_880 / call_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation instinct_880 / call_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, jacins_ruse, potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 76.2/100: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, jacins_ruse, potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 60.4/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, jacins_ruse, potion_of_the_old_war
0:03.014 tigers_fury Fluffy_Pillow 34.6/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, jacins_ruse, potion_of_the_old_war
0:03.014 berserk Fluffy_Pillow 94.6/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, tigers_fury, jacins_ruse, potion_of_the_old_war
0:03.014 shred Fluffy_Pillow 94.6/150: 63% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, jacins_ruse, potion_of_the_old_war
0:04.018 savage_roar Fluffy_Pillow 103.7/150: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, jacins_ruse, potion_of_the_old_war
0:05.022 shred Fluffy_Pillow 112.9/150: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:06.026 healing_touch Fluffy_Pillow 122.1/150: 81% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:06.779 ashamanes_frenzy Fluffy_Pillow 132.7/150: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:07.784 rip Fluffy_Pillow 146.9/150: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:08.789 shred Fluffy_Pillow 146.1/150: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:09.794 shred Fluffy_Pillow 140.3/150: 94% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
0:10.799 rake Fluffy_Pillow 134.5/150: 90% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
0:11.803 lunar_inspiration Fluffy_Pillow 131.5/150: 88% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:12.809 healing_touch Fluffy_Pillow 132.6/150: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:13.565 ferocious_bite Fluffy_Pillow 144.6/150: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, cleansed_ancients_blessing, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:14.570 rake Fluffy_Pillow 135.7/150: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:15.574 shred Fluffy_Pillow 134.2/150: 89% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
0:16.579 shred Fluffy_Pillow 130.2/150: 87% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
0:17.583 healing_touch Fluffy_Pillow 126.3/150: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
0:18.337 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
0:19.341 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:20.345 shred Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:21.349 shred Fluffy_Pillow 52.1/100: 52% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:22.352 healing_touch Fluffy_Pillow 28.1/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:23.107 savage_roar Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, blood_frenzy
0:24.112 rake Fluffy_Pillow 56.2/100: 56% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
0:25.116 lunar_inspiration Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:26.119 Waiting 1.113 sec 23.2/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:27.232 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:28.237 Waiting 1.501 sec 17.0/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy
0:29.738 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy
0:30.744 Waiting 1.794 sec 15.2/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:32.538 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:33.543 tigers_fury Fluffy_Pillow 14.7/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:33.543 healing_touch Fluffy_Pillow 74.7/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.298 rip Fluffy_Pillow 85.4/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:35.302 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.302 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.302 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.307 shred Fluffy_Pillow 94.2/100: 94% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:37.311 shred Fluffy_Pillow 83.4/100: 83% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:38.315 shred Fluffy_Pillow 57.5/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.320 lunar_inspiration Fluffy_Pillow 31.7/100: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:40.325 healing_touch Fluffy_Pillow 15.9/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:41.104 Waiting 0.500 sec 26.5/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
0:41.604 savage_roar Fluffy_Pillow 31.9/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:42.609 shred Fluffy_Pillow 42.8/100: 43% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:43.614 Waiting 2.437 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
0:46.051 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
0:47.055 Waiting 1.279 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:49.361 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:50.366 Waiting 1.790 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:52.156 healing_touch Fluffy_Pillow 31.5/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:53.079 rake Fluffy_Pillow 41.5/100: 42% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
0:54.084 Waiting 1.195 sec 17.5/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, cleansed_ancients_blessing
0:55.279 rip Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, cleansed_ancients_blessing
0:56.285 Waiting 1.756 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:58.041 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:59.045 Waiting 2.342 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy
1:01.387 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:02.390 Waiting 0.955 sec 13.3/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:03.345 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:03.543 shred Fluffy_Pillow 87.4/100: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:04.548 healing_touch Fluffy_Pillow 74.8/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:05.367 rip Fluffy_Pillow 84.8/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
1:06.370 rake Fluffy_Pillow 82.1/100: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:07.375 shred Fluffy_Pillow 74.5/100: 74% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:08.380 lunar_inspiration Fluffy_Pillow 46.8/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:09.384 healing_touch Fluffy_Pillow 27.8/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:10.309 Waiting 2.500 sec 37.8/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
1:12.809 savage_roar Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
1:13.814 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
1:14.818 Waiting 2.613 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:17.431 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:18.437 Waiting 2.477 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:20.914 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:21.918 healing_touch Fluffy_Pillow 52.8/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:22.739 Waiting 2.100 sec 62.8/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:24.839 rip Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:25.843 ashamanes_frenzy Fluffy_Pillow 71.0/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
1:26.848 rake Fluffy_Pillow 83.3/100: 83% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:27.852 healing_touch Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:28.670 savage_roar Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
1:29.675 lunar_inspiration Fluffy_Pillow 82.4/100: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:30.679 rake Fluffy_Pillow 63.3/100: 63% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:31.685 Waiting 0.100 sec 39.2/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar
1:31.785 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar
1:32.791 healing_touch Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:33.714 tigers_fury Fluffy_Pillow 21.2/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:33.714 Waiting 0.800 sec 81.2/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:34.514 rip Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:35.520 shred Fluffy_Pillow 85.8/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:36.524 shred Fluffy_Pillow 71.7/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:37.528 shred Fluffy_Pillow 57.6/100: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
1:38.534 healing_touch Fluffy_Pillow 68.6/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:39.458 Waiting 1.000 sec 78.6/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:40.458 ferocious_bite Fluffy_Pillow 89.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:41.464 rake Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:42.469 lunar_inspiration Fluffy_Pillow 26.3/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
1:43.473 Waiting 0.300 sec 37.2/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:43.773 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:44.778 Waiting 2.653 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:47.431 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:48.436 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:49.359 Waiting 2.955 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:52.314 rip Fluffy_Pillow 53.2/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:53.573 rake Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:54.579 Waiting 1.119 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:55.698 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
1:56.704 Waiting 0.400 sec 35.9/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:57.104 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:58.109 healing_touch Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
1:59.033 savage_roar Fluffy_Pillow 21.2/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
2:00.547 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
2:01.550 Waiting 1.953 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing
2:03.503 tigers_fury Fluffy_Pillow 34.8/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing
2:03.714 shred Fluffy_Pillow 97.1/100: 97% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
2:04.718 shred Fluffy_Pillow 83.0/100: 83% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
2:05.723 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, blood_frenzy
2:06.729 healing_touch Fluffy_Pillow 87.4/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, blood_frenzy
2:07.548 rip Fluffy_Pillow 97.4/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_wisps_blessing, blood_frenzy, jacins_ruse
2:08.554 rake Fluffy_Pillow 79.8/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, blood_frenzy, jacins_ruse
2:09.558 lunar_inspiration Fluffy_Pillow 57.1/100: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
2:10.563 shred Fluffy_Pillow 69.4/100: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
2:11.568 shred Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
2:12.575 healing_touch Fluffy_Pillow 14.1/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:13.393 savage_roar Fluffy_Pillow 24.2/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
2:14.396 Waiting 0.300 sec 36.5/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:14.696 rake Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:15.700 Waiting 2.100 sec 17.4/100: 17% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:17.800 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:18.805 Waiting 1.277 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:20.082 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
2:21.086 Waiting 0.400 sec 35.9/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:21.486 lunar_inspiration Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:22.492 Waiting 1.453 sec 21.2/100: 21% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:23.945 healing_touch Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:24.868 rake Fluffy_Pillow 47.0/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:25.873 Waiting 1.800 sec 24.3/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, blood_frenzy
2:27.673 rip Fluffy_Pillow 46.4/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, blood_frenzy
2:28.677 Waiting 1.000 sec 28.7/100: 29% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:29.677 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:30.682 Waiting 2.048 sec 13.4/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:32.730 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
2:33.735 tigers_fury Fluffy_Pillow 14.3/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
2:33.735 shred Fluffy_Pillow 74.3/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, blood_frenzy
2:34.739 healing_touch Fluffy_Pillow 63.0/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, blood_frenzy
2:35.567 Waiting 0.200 sec 73.2/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_sisters_blessing
2:35.767 rip Fluffy_Pillow 90.7/100: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_sisters_blessing
2:36.772 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:36.772 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:36.772 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:37.775 lunar_inspiration Fluffy_Pillow 77.2/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:38.779 shred Fluffy_Pillow 59.5/100: 59% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:39.785 Waiting 0.700 sec 31.7/100: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:40.485 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:41.490 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
2:42.415 Waiting 2.267 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:44.682 savage_roar Fluffy_Pillow 49.5/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), cleansed_ancients_blessing, blood_frenzy
2:45.685 ashamanes_frenzy Fluffy_Pillow 21.9/100: 22% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy
2:46.691 shred Fluffy_Pillow 34.2/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy
2:47.696 shred Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy
2:48.702 healing_touch Fluffy_Pillow 18.9/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy
2:49.520 Waiting 0.100 sec 29.0/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing, blood_frenzy
2:49.620 rip Fluffy_Pillow 30.2/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing, blood_frenzy
2:52.668 rake Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy
2:53.673 Waiting 1.219 sec 14.9/100: 15% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy
2:54.892 lunar_inspiration Fluffy_Pillow 29.9/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
2:55.895 shred Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:56.900 healing_touch Fluffy_Pillow 14.6/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:57.719 Waiting 3.100 sec 24.6/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
3:00.819 savage_roar Fluffy_Pillow 62.7/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
3:02.076 rake Fluffy_Pillow 38.1/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
3:03.080 Waiting 0.962 sec 14.5/100: 15% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:04.042 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:04.042 berserk Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:04.042 shred Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:05.047 lunar_inspiration Fluffy_Pillow 90.9/150: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:06.051 shred Fluffy_Pillow 101.8/150: 68% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:07.054 healing_touch Fluffy_Pillow 107.7/150: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:07.978 rip Fluffy_Pillow 117.7/150: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury
3:08.983 rake Fluffy_Pillow 113.7/150: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury
3:09.987 shred Fluffy_Pillow 107.1/150: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:10.991 shred Fluffy_Pillow 98.0/150: 65% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:11.995 healing_touch Fluffy_Pillow 88.9/150: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:12.920 ferocious_bite Fluffy_Pillow 98.9/150: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:13.923 shred Fluffy_Pillow 84.8/150: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:14.927 shred Fluffy_Pillow 75.7/150: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar
3:15.931 shred Fluffy_Pillow 66.6/150: 44% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, berserk, predatory_swiftness, savage_roar
3:16.935 healing_touch Fluffy_Pillow 77.5/150: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar
3:17.860 ferocious_bite Fluffy_Pillow 87.6/150: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar
3:18.866 rake Fluffy_Pillow 86.0/150: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:19.870 lunar_inspiration Fluffy_Pillow 79.4/100: 79% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:20.875 shred Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:21.880 healing_touch Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:22.804 Waiting 3.800 sec 41.3/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:26.604 rip Fluffy_Pillow 82.5/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:27.609 rake Fluffy_Pillow 63.5/100: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:28.616 Waiting 0.100 sec 39.4/100: 39% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:28.716 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:29.720 Waiting 1.253 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:30.973 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
3:31.978 Waiting 0.400 sec 35.9/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:32.378 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, jacins_ruse
3:33.385 Waiting 1.270 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, jacins_ruse
3:34.655 tigers_fury Fluffy_Pillow 26.7/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
3:34.655 lunar_inspiration Fluffy_Pillow 86.7/100: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
3:35.660 healing_touch Fluffy_Pillow 84.0/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
3:36.477 savage_roar Fluffy_Pillow 94.0/100: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
3:37.482 rake Fluffy_Pillow 81.4/100: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
3:38.486 shred Fluffy_Pillow 73.7/100: 74% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
3:39.493 shred Fluffy_Pillow 46.1/100: 46% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
3:40.500 healing_touch Fluffy_Pillow 18.4/100: 18% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
3:41.317 Waiting 1.400 sec 28.5/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
3:42.717 rip Fluffy_Pillow 45.7/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
3:44.489 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:45.496 Waiting 1.705 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:47.201 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:48.206 Waiting 2.557 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:50.763 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:51.767 Waiting 1.501 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:53.268 healing_touch Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:54.091 rake Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
3:55.097 Waiting 1.842 sec 18.4/100: 18% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar, cleansed_sisters_blessing
3:56.939 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar, cleansed_sisters_blessing
3:57.943 Waiting 1.478 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points savage_roar, cleansed_sisters_blessing
3:59.421 rip Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points savage_roar, cleansed_sisters_blessing
4:00.424 Waiting 1.666 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
4:02.090 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness
4:03.093 healing_touch Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, cleansed_wisps_blessing
4:04.018 Waiting 0.435 sec 21.4/100: 21% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), cleansed_wisps_blessing
4:04.453 tigers_fury Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), cleansed_wisps_blessing
4:04.655 rake Fluffy_Pillow 88.3/100: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, cleansed_wisps_blessing
4:05.660 shred Fluffy_Pillow 79.2/100: 79% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, tigers_fury, cleansed_wisps_blessing
4:06.665 savage_roar Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, tigers_fury, cleansed_wisps_blessing
4:07.670 shred Fluffy_Pillow 52.1/100: 52% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
4:08.675 Waiting 1.300 sec 24.4/100: 24% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
4:09.975 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing, blood_frenzy
4:10.978 Waiting 1.946 sec 14.8/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing, blood_frenzy
4:12.924 shred Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
4:13.929 Waiting 1.135 sec 15.0/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
4:15.064 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
4:16.067 healing_touch Fluffy_Pillow 14.1/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
4:16.822 Waiting 0.500 sec 24.4/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, blood_frenzy
4:17.322 rip Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
4:18.325 ashamanes_frenzy Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:20.349 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:21.355 shred Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
4:22.361 healing_touch Fluffy_Pillow 23.0/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:23.283 Waiting 5.200 sec 33.1/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:28.483 rip Fluffy_Pillow 89.5/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing
4:29.487 rake Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
4:30.492 lunar_inspiration Fluffy_Pillow 46.4/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
4:31.497 Waiting 1.200 sec 27.3/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, cleansed_wisps_blessing, jacins_ruse
4:32.697 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, cleansed_wisps_blessing, jacins_ruse
4:33.704 Waiting 1.266 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, cleansed_wisps_blessing, jacins_ruse
4:34.970 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, cleansed_wisps_blessing, jacins_ruse
4:34.970 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, cleansed_wisps_blessing, jacins_ruse
4:35.975 healing_touch Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, cleansed_wisps_blessing, jacins_ruse
4:36.899 savage_roar Fluffy_Pillow 80.9/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, jacins_ruse
4:37.904 shadowmeld Fluffy_Pillow 66.9/100: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:37.904 rake Fluffy_Pillow 66.9/100: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:37.904 auto_attack Fluffy_Pillow 31.9/100: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:38.909 shred Fluffy_Pillow 57.8/100: 58% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:39.916 shred Fluffy_Pillow 29.0/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:40.919 shred Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:41.924 healing_touch Fluffy_Pillow 13.6/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:42.744 Waiting 2.707 sec 23.7/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:45.451 rip Fluffy_Pillow 56.9/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
4:46.455 lunar_inspiration Fluffy_Pillow 69.2/100: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:47.459 shred Fluffy_Pillow 51.6/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:48.462 Waiting 1.400 sec 23.9/100: 24% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:49.862 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
4:53.170 rake Fluffy_Pillow 36.8/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
4:54.174 Waiting 1.828 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
4:56.002 healing_touch Fluffy_Pillow 32.6/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
4:56.926 rake Fluffy_Pillow 42.6/100: 43% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_wisps_blessing
4:57.932 Waiting 3.000 sec 53.6/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, cleansed_wisps_blessing
5:00.932 savage_roar Fluffy_Pillow 86.1/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons
5:01.937 lunar_inspiration Fluffy_Pillow 57.1/100: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:02.940 Waiting 0.100 sec 37.9/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:03.040 rake Fluffy_Pillow 39.0/100: 39% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:04.045 Waiting 0.925 sec 14.9/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:04.970 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:04.970 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:05.975 healing_touch Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:06.899 rip Fluffy_Pillow 80.9/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:07.902 shred Fluffy_Pillow 76.8/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:08.908 shred Fluffy_Pillow 62.8/100: 63% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
5:09.911 Waiting 0.600 sec 33.7/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:10.511 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:11.514 Waiting 1.582 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:13.096 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:14.102 healing_touch Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:14.921 Waiting 0.676 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:15.597 rip Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:18.389 rake Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:19.392 Waiting 0.999 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:20.391 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy
5:21.394 Waiting 0.200 sec 37.4/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing, blood_frenzy
5:21.594 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
5:22.600 Waiting 1.241 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
5:23.841 shred Fluffy_Pillow 27.4/100: 27% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
5:24.843 Waiting 0.100 sec 39.6/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
5:24.943 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, cleansed_ancients_blessing, cleansed_sisters_blessing
5:25.948 healing_touch Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, cleansed_ancients_blessing, cleansed_sisters_blessing
5:28.304 savage_roar Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), cleansed_ancients_blessing, cleansed_sisters_blessing
5:31.098 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_sisters_blessing
5:32.102 lunar_inspiration Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:33.107 Waiting 1.079 sec 23.1/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar
5:34.441 rake Fluffy_Pillow 37.5/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar
5:35.444 tigers_fury Fluffy_Pillow 13.4/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:35.444 healing_touch Fluffy_Pillow 73.4/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:36.369 Waiting 0.100 sec 83.5/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:36.469 rip Fluffy_Pillow 99.6/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:37.475 ashamanes_frenzy Fluffy_Pillow 95.5/100: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:38.479 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
5:39.483 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:40.488 healing_touch Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:41.412 Waiting 0.800 sec 81.0/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:42.212 savage_roar Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:43.218 rake Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
5:44.223 lunar_inspiration Fluffy_Pillow 36.5/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:45.228 Waiting 2.099 sec 17.4/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:47.327 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:48.330 Waiting 1.380 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:49.710 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:50.715 Waiting 1.596 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:52.311 shred Fluffy_Pillow 28.3/100: 28% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:53.315 healing_touch Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:54.135 rake Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
5:55.140 shred Fluffy_Pillow 63.0/100: 63% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, savage_roar, blood_frenzy
5:56.145 lunar_inspiration Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points savage_roar, blood_frenzy
5:57.150 Waiting 5.393 sec 17.7/100: 18% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points savage_roar, blood_frenzy
6:02.543 ferocious_bite Fluffy_Pillow 83.6/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points savage_roar, jacins_ruse
6:03.548 shred Fluffy_Pillow 44.5/100: 44% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:04.553 shred Fluffy_Pillow 15.4/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
6:05.558 tigers_fury Fluffy_Pillow 26.3/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:05.558 berserk Fluffy_Pillow 86.3/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:05.558 potion Fluffy_Pillow 86.3/150: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:05.558 shred Fluffy_Pillow 86.3/150: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:06.563 rake Fluffy_Pillow 92.2/150: 61% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:07.567 healing_touch Fluffy_Pillow 100.6/150: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:08.491 savage_roar Fluffy_Pillow 110.7/150: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:09.496 shred Fluffy_Pillow 136.7/150: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:10.501 rake Fluffy_Pillow 129.1/150: 86% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:11.505 lunar_inspiration Fluffy_Pillow 123.9/150: 83% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:12.509 shred Fluffy_Pillow 121.2/150: 81% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:13.512 healing_touch Fluffy_Pillow 113.6/150: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:14.331 ferocious_bite Fluffy_Pillow 123.6/150: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:15.335 shred Fluffy_Pillow 110.9/150: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:16.340 shred Fluffy_Pillow 103.3/150: 69% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:17.344 shred Fluffy_Pillow 95.6/150: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:18.349 shred Fluffy_Pillow 87.9/150: 59% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:19.353 shred Fluffy_Pillow 80.3/150: 54% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:20.357 healing_touch Fluffy_Pillow 71.2/150: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:21.282 Waiting 0.800 sec 81.2/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse, potion_of_the_old_war
6:22.082 ferocious_bite Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse, potion_of_the_old_war
6:23.086 rake Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:24.091 Waiting 0.300 sec 26.8/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:24.391 lunar_inspiration Fluffy_Pillow 30.0/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:25.395 Waiting 2.696 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:28.091 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, potion_of_the_old_war
6:29.096 Waiting 1.278 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, potion_of_the_old_war
6:30.374 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing, potion_of_the_old_war
6:31.378 healing_touch Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:32.303 savage_roar Fluffy_Pillow 46.0/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing
6:33.307 rake Fluffy_Pillow 56.9/100: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:34.312 Waiting 0.700 sec 32.8/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:35.012 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
6:36.017 tigers_fury Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:36.017 shred Fluffy_Pillow 71.3/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:37.021 shred Fluffy_Pillow 57.2/100: 57% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:38.025 healing_touch Fluffy_Pillow 43.1/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:38.950 Waiting 1.100 sec 53.1/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:40.050 ferocious_bite Fluffy_Pillow 80.1/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
6:41.053 shadowmeld Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
6:41.053 rake Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
6:41.053 auto_attack Fluffy_Pillow 6.0/100: 6% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
6:42.058 Waiting 1.245 sec 16.9/100: 17% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
6:43.303 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
6:44.308 Waiting 2.657 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:46.965 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:47.970 Waiting 2.269 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:50.239 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:51.244 healing_touch Fluffy_Pillow 13.3/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:52.062 Waiting 1.435 sec 23.3/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
6:53.497 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
6:54.503 ashamanes_frenzy Fluffy_Pillow 13.3/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
6:56.275 ferocious_bite Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
6:59.585 rake Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:00.589 Waiting 1.620 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:02.209 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:03.214 Waiting 1.257 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:04.471 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:05.395 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:06.401 tigers_fury Fluffy_Pillow 11.0/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, savage_roar, jacins_ruse
7:06.401 shred Fluffy_Pillow 71.0/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
7:07.403 Waiting 1.600 sec 56.8/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
7:09.003 ferocious_bite Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
7:10.009 shred Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
7:11.015 Waiting 0.400 sec 36.1/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
7:11.415 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
7:12.419 Waiting 1.759 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
7:14.178 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
7:15.183 healing_touch Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:16.108 Waiting 1.732 sec 21.4/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:17.840 savage_roar Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:21.143 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:22.148 shred Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
7:23.150 Waiting 1.595 sec 22.9/100: 23% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:24.745 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:25.749 healing_touch Fluffy_Pillow 12.5/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:26.566 Waiting 0.399 sec 22.6/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
7:26.965 ferocious_bite Fluffy_Pillow 27.5/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
7:27.970 Waiting 2.131 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 23361 21655 11591 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 28033 25986 0
Crit 34.77% 34.77% 6568
Haste 8.61% 8.61% 2799
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 23361 21655 0
Mastery 53.68% 51.54% 6219
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 849.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Nature's Call
ilevel: 880, stats: { +348 Mastery, +348 Haste, +348 Crit }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="instinct_880 / call_880"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=natures_call,id=139334,bonus_id=1806
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=848.75
# gear_agility=11591
# gear_stamina=17628
# gear_crit_rating=6568
# gear_haste_rating=1866
# gear_mastery_rating=6219
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

instinct_880 / pod_880 : 328671 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
328671.2 328671.2 396.2 / 0.121% 39218.1 / 11.9% 21295.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.4 15.4 Energy 29.67% 45.4 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
instinct_880 / pod_880 328671
Ashamane's Frenzy 15051 4.6% 6.1 78.28sec 1104548 1099785 Direct 91.7 10283 20555 13742 33.7%  
Periodic 30.3 135937 272251 181939 33.7% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.13 91.69 121.99 30.29 1.0045 0.6470 6771378.51 7363678.36 8.04 79583.69 1099785.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.82 66.33% 10283.02 7641 12224 10285.44 9410 11330 625419 919425 31.98
crit 30.87 33.67% 20554.79 15281 24448 20554.00 18473 23040 634540 932833 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.1 66.26% 135936.85 84242 168476 135965.87 123146 154016 2728726 2728726 0.00
crit 10.2 33.74% 272250.84 168484 336952 272168.22 231502 319038 2782694 2782694 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 39151 11.9% 19.3 22.09sec 912162 0 Periodic 152.8 86195 172469 115346 33.8% 43.8%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.32 0.00 152.81 152.81 0.0000 1.2907 17626012.74 17626012.74 0.00 89368.26 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 101.2 66.21% 86195.17 60 102052 86123.14 74292 93538 8721051 8721051 0.00
crit 51.6 33.79% 172468.61 152 204104 172324.53 147940 189881 8904962 8904962 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 31017 9.4% 541.5 0.83sec 25769 31140 Direct 541.5 19264 38537 25769 33.8%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 541.45 541.45 0.00 0.00 0.8275 0.0000 13952679.14 20511759.96 31.98 31139.99 31139.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 358.69 66.25% 19263.57 14990 21547 19263.32 18917 19520 6909712 10157931 31.98
crit 182.76 33.75% 38537.32 29979 43095 38537.61 37605 39373 7042967 10353829 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 7623 2.3% 11.5 40.81sec 298241 296928 Direct 11.5 213182 468088 298219 33.4%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.49 11.49 0.00 0.00 1.0045 0.0000 3425659.82 5036044.42 31.98 296928.13 296928.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.65 66.64% 213182.49 15790 271087 212941.43 120803 259301 1631615 2398628 31.98
crit 3.83 33.36% 468087.80 35921 599103 459089.70 0 599103 1794045 2637416 31.44
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Infested Ground 6074 1.8% 7.8 60.69sec 348244 0 Direct 77.6 26322 52650 35223 33.8%  

Stats details: infested_ground

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.84 77.56 0.00 0.00 0.0000 0.0000 2731881.50 2731881.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.34 66.19% 26322.08 19237 27653 26322.45 24877 27017 1351409 1351409 0.00
crit 26.22 33.81% 52650.30 38474 55306 52653.51 49185 55306 1380472 1380472 0.00
 
 

Action details: infested_ground

Static Values
  • id:221803
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221803
  • name:Infested Ground
  • school:shadow
  • tooltip:
  • description:Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.
 
Moonfire (lunar_inspiration) 25278 7.7% 31.7 14.28sec 358287 356690 Direct 31.7 35718 71333 47795 33.9%  
Periodic 267.8 27511 55024 36799 33.8% 97.2%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.73 31.73 267.75 267.75 1.0045 1.6339 11369850.49 11369850.49 0.00 24224.11 356690.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.97 66.08% 35717.98 27761 39907 35717.81 33617 37825 749014 749014 0.00
crit 10.76 33.92% 71333.24 55522 79813 71332.58 63454 79813 767762 767762 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.4 66.24% 27510.89 12 31039 27510.96 26679 28140 4879363 4879363 0.00
crit 90.4 33.76% 55024.09 30 62078 55025.44 51971 57028 4973712 4973712 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2345 0.7% 25.9 17.17sec 40707 0 Periodic 76.5 13785 0 13785 0.0% 8.4%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.90 0.00 76.50 76.50 0.0000 0.4968 1054496.81 1550210.19 31.98 27750.65 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.5 100.00% 13785.08 27 15493 13787.24 12894 14583 1054497 1550210 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11860 3.6% 25.1 16.47sec 209947 0 Direct 25.1 156630 313651 209945 34.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.07 25.07 0.00 0.00 0.0000 0.0000 5263702.67 7738141.52 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.56 66.04% 156630.03 122075 175482 156597.90 143160 166899 2593485 3812668 31.98
crit 8.51 33.96% 313651.35 244149 350964 313589.02 264495 350964 2670218 3925473 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 71763 21.8% 47.5 9.48sec 678978 675950 Direct 47.5 88272 176332 117896 33.6%  
Periodic 223.9 89133 178041 119157 33.8% 95.2%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.55 47.55 223.89 223.89 1.0045 1.9143 32283364.59 32283364.59 0.00 67774.07 675949.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.55 66.36% 88272.05 41310 198278 88316.48 76035 100956 2785507 2785507 0.00
crit 15.99 33.64% 176332.33 82620 396555 176296.99 138569 232771 2819843 2819843 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.3 66.23% 89133.03 39 198278 89153.01 78599 98005 13217676 13217676 0.00
crit 75.6 33.77% 178040.86 77 396555 178087.63 151055 207586 13460338 13460338 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 86291 26.3% 23.1 15.21sec 1680472 1672992 Periodic 327.7 88627 177257 118548 33.8% 96.6%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.12 0.00 327.68 327.68 1.0045 1.3267 38845201.69 38845201.69 0.00 84825.78 1672992.02
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 217.1 66.24% 88626.92 66 102052 88619.63 83169 93523 19237248 19237248 0.00
crit 110.6 33.76% 177257.29 137 204104 177249.06 163957 188780 19607953 19607953 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 32218 9.8% 115.8 3.88sec 125008 124448 Direct 115.8 93411 186734 125004 33.9%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.83 115.83 0.00 0.00 1.0045 0.0000 14479956.30 21286907.34 31.98 124448.50 124448.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.62 66.14% 93411.10 65348 140906 93427.90 87537 98964 7156615 10520902 31.98
crit 39.22 33.86% 186734.33 130695 281811 186686.86 170482 206734 7323341 10766005 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
instinct_880 / pod_880
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_880 / pod_880
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.07sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_880 / pod_880
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_880 / pod_880
  • harmful:false
  • if_expr:
 
Healing Touch 51.9 8.76sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 51.88 0.00 0.00 0.00 0.8285 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.8 24.37sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.80 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.16sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.35sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.19 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.4sec 30.4sec 10.10% 10.17% 45.4(45.4) 15.1

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.1sec 182.1sec 9.78% 14.43% 0.0(0.0) 2.9

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Blood Frenzy 14.7 7.7 30.6sec 19.6sec 40.22% 40.28% 7.7(7.7) 14.2

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:3069.72

Stack Uptimes

  • blood_frenzy_1:40.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 7.65% 0.0(0.0) 1.0

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 51.9 0.0 8.7sec 8.8sec 45.62% 45.65% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.38%
  • bloodtalons_2:27.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 45.8 1.6 9.7sec 9.3sec 6.81% 15.45% 1.6(1.6) 0.0

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.81%

Trigger Attempt Success

  • trigger_pct:8.76%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.8 63.7sec 48.4sec 24.72% 24.81% 1.8(1.8) 6.4

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Leeching Pestilence 7.8 0.0 60.7sec 60.7sec 17.26% 17.35% 0.0(0.0) 7.7

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_leeching_pestilence
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:leech_rating
  • amount:2037.36

Stack Uptimes

  • leeching_pestilence_1:17.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221805
  • name:Leeching Pestilence
  • tooltip:Leech increased by $w1.
  • description:{$@spelldesc221803=Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.3sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 51.6 1.1 8.7sec 8.5sec 74.74% 74.75% 1.1(1.1) 0.0

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.74%

Trigger Attempt Success

  • trigger_pct:98.75%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 7.5 11.3 51.3sec 24.4sec 94.31% 94.05% 202.2(202.2) 6.5

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:94.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.2sec 133.2sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.4sec 30.4sec 26.77% 28.91% 0.0(0.0) 14.9

Buff details

  • buff initial source:instinct_880 / pod_880
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
instinct_880 / pod_880
ferocious_bite Energy 23.0 397.3 17.3 34.6 8622.5
ferocious_bite Combo Points 11.5 54.1 4.7 4.7 63376.2
lunar_inspiration Energy 31.7 786.0 24.8 24.8 14465.3
rake Energy 47.5 1351.4 28.4 28.4 23889.4
rip Energy 23.1 464.3 20.1 20.1 83655.6
rip Combo Points 23.1 115.6 5.0 5.0 336090.7
savage_roar Energy 18.8 483.2 25.7 25.7 0.0
savage_roar Combo Points 18.8 94.0 5.0 5.0 0.0
shred Energy 115.8 3458.5 29.9 29.9 4186.7
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.55 47.55 (17.82%) 1.00 0.00 0.00%
tigers_fury Energy 15.19 911.11 (10.76%) 59.97 0.50 0.06%
ashamanes_frenzy Combo Points 6.13 18.39 (6.89%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.73 31.73 (11.89%) 1.00 0.00 0.00%
shred Combo Points 115.84 115.84 (43.41%) 1.00 0.00 0.00%
energy_regen Energy 2112.28 5339.21 (63.04%) 2.53 87.49 1.61%
clearcasting Energy 45.68 1560.35 (18.42%) 34.16 0.00 0.00%
ashamanes_energy Energy 45.39 658.98 (7.78%) 14.52 21.81 3.20%
primal_fury Combo Points 65.97 53.35 (19.99%) 0.81 12.62 19.13%
Resource RPS-Gain RPS-Loss
Energy 15.35 15.42
Combo Points 0.59 0.59
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 37.89 0.04 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.20 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.0%

Procs

Count Interval
clearcasting 47.4 9.3sec
clearcasting_wasted 1.6 115.2sec
primal_fury 66.0 6.8sec

Statistics & Data Analysis

Fight Length
Sample Data instinct_880 / pod_880 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data instinct_880 / pod_880 Damage Per Second
Count 2499
Mean 328671.24
Minimum 293575.35
Maximum 366413.97
Spread ( max - min ) 72838.62
Range [ ( max - min ) / 2 * 100% ] 11.08%
Standard Deviation 10104.5223
5th Percentile 312278.84
95th Percentile 345140.80
( 95th Percentile - 5th Percentile ) 32861.96
Mean Distribution
Standard Deviation 202.1309
95.00% Confidence Intervall ( 328275.07 - 329067.41 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3630
0.1 Scale Factor Error with Delta=300 871596
0.05 Scale Factor Error with Delta=300 3486384
0.01 Scale Factor Error with Delta=300 87159603
Priority Target DPS
Sample Data instinct_880 / pod_880 Priority Target Damage Per Second
Count 2499
Mean 328671.24
Minimum 293575.35
Maximum 366413.97
Spread ( max - min ) 72838.62
Range [ ( max - min ) / 2 * 100% ] 11.08%
Standard Deviation 10104.5223
5th Percentile 312278.84
95th Percentile 345140.80
( 95th Percentile - 5th Percentile ) 32861.96
Mean Distribution
Standard Deviation 202.1309
95.00% Confidence Intervall ( 328275.07 - 329067.41 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3630
0.1 Scale Factor Error with Delta=300 871596
0.05 Scale Factor Error with Delta=300 3486384
0.01 Scale Factor Error with Delta=300 87159603
DPS(e)
Sample Data instinct_880 / pod_880 Damage Per Second (Effective)
Count 2499
Mean 328671.24
Minimum 293575.35
Maximum 366413.97
Spread ( max - min ) 72838.62
Range [ ( max - min ) / 2 * 100% ] 11.08%
Damage
Sample Data instinct_880 / pod_880 Damage
Count 2499
Mean 147804184.26
Minimum 110992005.14
Maximum 185794395.55
Spread ( max - min ) 74802390.42
Range [ ( max - min ) / 2 * 100% ] 25.30%
DTPS
Sample Data instinct_880 / pod_880 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data instinct_880 / pod_880 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data instinct_880 / pod_880 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data instinct_880 / pod_880 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data instinct_880 / pod_880 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data instinct_880 / pod_880 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data instinct_880 / pod_880Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data instinct_880 / pod_880 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.57 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.57 auto_attack
0.00 skull_bash
A 2.95 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 7.84 use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
C 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
D 15.20 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
E 3.66 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
F 50.88 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
J 7.52 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
K 23.12 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
L 11.28 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
M 7.83 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
N 6.13 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
O 3.57 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
P 42.98 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
Q 31.73 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
R 115.84 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789QRDABRJRRFNKRPQRFMPRRRFKRRRRFLPQRRDFKO89RRRFLQRRFKRPRFMPQDBRRFKPRRQFJPRRFKNQRFLDPRRFKPQRRFKPQRRFLPDBRRRFKPQRFLPRQRFKPRDRRFKO89QFNLRRRPFQKPRDABRRFKPQRRFLRPRRFMQRRRFKPRQDFKPRRFJPRRRFKPQRRFLNPDBRFKQPRRFMPRRQFKPRRFJPDQRRFKO89RRFLQRPRRFKPQDBRFKPRRRFLPQNFKPRRRFMPQDRRRFEPQRFJPREQRDABCPRFKPRRQRFLPRRFMRRRQFLPRDRFMNRFMO89QRRFLPQPERDBRRQFMPRRRFLPQR

Sample Sequence Table

time name target resources buffs
Pre flask instinct_880 / pod_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food instinct_880 / pod_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation instinct_880 / pod_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.003 lunar_inspiration Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.009 shred Fluffy_Pillow 61.2/100: 61% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:03.013 tigers_fury Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, potion_of_the_old_war
0:03.013 berserk Fluffy_Pillow 95.8/100: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:03.013 use_item_ravaged_seed_pod Fluffy_Pillow 95.8/150: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:03.013 shred Fluffy_Pillow 95.8/150: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:04.018 savage_roar Fluffy_Pillow 105.4/150: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:05.022 shred Fluffy_Pillow 135.0/150: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:06.027 shred Fluffy_Pillow 144.6/150: 96% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:07.032 healing_touch Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:07.787 ashamanes_frenzy Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:08.793 rip Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:09.797 shred Fluffy_Pillow 149.6/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:10.800 rake Fluffy_Pillow 144.2/150: 96% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:11.803 lunar_inspiration Fluffy_Pillow 141.3/150: 94% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
0:12.805 shred Fluffy_Pillow 141.1/150: 94% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, blood_frenzy, potion_of_the_old_war
0:13.810 healing_touch Fluffy_Pillow 137.5/150: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:14.564 ferocious_bite Fluffy_Pillow 149.9/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, blood_frenzy, potion_of_the_old_war
0:15.569 rake Fluffy_Pillow 141.3/150: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:16.574 shred Fluffy_Pillow 140.3/150: 94% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:17.578 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:18.583 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:19.588 healing_touch Fluffy_Pillow 76.5/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:20.342 rip Fluffy_Pillow 88.8/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, blood_frenzy, potion_of_the_old_war
0:21.347 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:22.353 shred Fluffy_Pillow 76.5/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:23.358 shred Fluffy_Pillow 51.7/100: 52% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.362 Waiting 0.200 sec 26.3/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.562 shred Fluffy_Pillow 29.2/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:25.565 healing_touch Fluffy_Pillow 43.8/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:26.319 Waiting 0.900 sec 54.7/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:27.219 savage_roar Fluffy_Pillow 67.8/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:28.224 rake Fluffy_Pillow 43.0/100: 43% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
0:29.227 Waiting 0.400 sec 24.4/100: 24% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:29.627 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:30.632 shred Fluffy_Pillow 17.5/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:31.636 Waiting 0.400 sec 33.9/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy
0:32.036 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy
0:33.041 tigers_fury Fluffy_Pillow 16.9/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy
0:33.041 healing_touch Fluffy_Pillow 76.9/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:33.794 rip Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
0:34.797 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:34.797 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:34.797 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:35.802 shred Fluffy_Pillow 96.5/100: 96% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:36.807 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:37.812 shred Fluffy_Pillow 76.5/100: 76% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:38.816 healing_touch Fluffy_Pillow 51.2/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.570 Waiting 2.000 sec 62.2/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, tigers_fury
0:41.570 savage_roar Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:42.576 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:43.580 shred Fluffy_Pillow 81.2/100: 81% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:44.584 shred Fluffy_Pillow 52.5/100: 52% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
0:45.589 healing_touch Fluffy_Pillow 23.7/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:46.488 Waiting 0.300 sec 33.7/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:46.788 rip Fluffy_Pillow 37.1/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:47.793 shred Fluffy_Pillow 18.3/100: 18% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
0:49.310 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:50.314 Waiting 2.156 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:52.470 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:53.475 healing_touch Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:54.272 Waiting 5.273 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
0:59.545 ferocious_bite Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:00.549 rake Fluffy_Pillow 50.1/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:01.553 Waiting 0.400 sec 26.4/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:01.953 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:02.959 tigers_fury Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:03.041 use_item_ravaged_seed_pod Fluffy_Pillow 73.0/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:03.041 shred Fluffy_Pillow 73.0/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:04.045 shred Fluffy_Pillow 59.2/100: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:05.050 healing_touch Fluffy_Pillow 85.5/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:05.952 rip Fluffy_Pillow 95.6/100: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
1:06.957 rake Fluffy_Pillow 91.8/100: 92% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:07.962 shred Fluffy_Pillow 68.0/100: 68% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:08.967 Waiting 0.100 sec 39.3/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:09.067 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:10.073 Waiting 1.694 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:11.767 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, leeching_pestilence
1:12.773 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, leeching_pestilence
1:15.462 savage_roar Fluffy_Pillow 41.9/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
1:18.513 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:19.516 shred Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
1:20.521 Waiting 1.536 sec 23.5/100: 23% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:22.057 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:23.062 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:23.960 Waiting 0.774 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:24.734 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:25.740 ashamanes_frenzy Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:26.745 lunar_inspiration Fluffy_Pillow 23.1/100: 23% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
1:27.748 Waiting 0.600 sec 34.3/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:28.348 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:29.354 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:30.252 Waiting 1.642 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:31.894 savage_roar Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:32.900 tigers_fury Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
1:33.041 rake Fluffy_Pillow 73.5/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:34.046 shred Fluffy_Pillow 64.7/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:35.051 shred Fluffy_Pillow 50.9/100: 51% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:36.056 healing_touch Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:36.953 Waiting 3.800 sec 47.2/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
1:40.753 rip Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:41.755 rake Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:42.760 lunar_inspiration Fluffy_Pillow 48.6/100: 49% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
1:43.764 shred Fluffy_Pillow 61.2/100: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:44.768 Waiting 0.500 sec 33.9/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:45.268 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:46.271 healing_touch Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:47.068 Waiting 4.670 sec 22.9/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:51.738 rip Fluffy_Pillow 81.7/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:52.742 rake Fluffy_Pillow 62.9/100: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:53.746 Waiting 0.100 sec 39.2/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:53.846 lunar_inspiration Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:54.850 Waiting 1.711 sec 21.5/100: 22% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:56.561 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:57.565 Waiting 2.231 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:59.796 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:00.801 healing_touch Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
2:01.600 savage_roar Fluffy_Pillow 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
2:02.606 rake Fluffy_Pillow 35.5/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
2:03.609 tigers_fury Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:03.609 use_item_ravaged_seed_pod Fluffy_Pillow 73.1/100: 73% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:03.609 shred Fluffy_Pillow 73.1/100: 73% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
2:04.613 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
2:05.617 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
2:06.623 healing_touch Fluffy_Pillow 87.7/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
2:07.420 rip Fluffy_Pillow 97.7/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
2:08.424 rake Fluffy_Pillow 79.0/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:09.428 lunar_inspiration Fluffy_Pillow 55.2/100: 55% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:10.433 Waiting 0.400 sec 36.5/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:10.833 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:11.837 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, leeching_pestilence
2:12.736 Waiting 5.747 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, leeching_pestilence
2:18.483 savage_roar Fluffy_Pillow 87.7/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
2:19.487 rake Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
2:20.491 Waiting 0.200 sec 38.0/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:20.691 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:21.696 Waiting 1.340 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:23.036 lunar_inspiration Fluffy_Pillow 30.0/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:24.041 Waiting 2.176 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:26.217 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:27.222 healing_touch Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:28.018 Waiting 0.574 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
2:28.592 rip Fluffy_Pillow 30.0/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
2:29.597 rake Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:30.601 Waiting 1.200 sec 25.3/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:31.801 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:32.807 Waiting 1.211 sec 11.5/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:34.018 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:34.018 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:35.020 shred Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:36.024 healing_touch Fluffy_Pillow 57.4/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:36.923 rip Fluffy_Pillow 67.5/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:37.927 shadowmeld Fluffy_Pillow 93.7/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:37.927 rake Fluffy_Pillow 93.7/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:37.927 auto_attack Fluffy_Pillow 58.7/100: 59% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
2:38.931 lunar_inspiration Fluffy_Pillow 69.9/100: 70% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
2:39.936 healing_touch Fluffy_Pillow 51.2/100: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:40.835 ashamanes_frenzy Fluffy_Pillow 61.2/100: 61% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar, tigers_fury
2:41.842 Waiting 1.500 sec 72.5/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, tigers_fury
2:43.342 savage_roar Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
2:44.346 shred Fluffy_Pillow 60.5/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:45.350 Waiting 0.800 sec 31.7/100: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:46.150 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:47.156 Waiting 2.570 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:49.726 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:50.731 Waiting 1.172 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:52.923 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:53.929 healing_touch Fluffy_Pillow 12.6/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:54.829 Waiting 0.704 sec 22.7/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
2:55.533 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
2:56.538 Waiting 1.678 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:58.216 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:01.272 rake Fluffy_Pillow 34.8/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
3:02.275 shred Fluffy_Pillow 46.0/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:03.280 Waiting 0.696 sec 17.2/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:03.976 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
3:04.018 berserk Fluffy_Pillow 85.5/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:04.018 use_item_ravaged_seed_pod Fluffy_Pillow 85.5/150: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:04.018 shred Fluffy_Pillow 85.5/150: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:05.022 shred Fluffy_Pillow 111.7/150: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:06.027 healing_touch Fluffy_Pillow 117.9/150: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:06.926 rip Fluffy_Pillow 128.0/150: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence
3:07.929 rake Fluffy_Pillow 140.6/150: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
3:08.935 lunar_inspiration Fluffy_Pillow 135.8/150: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
3:09.939 shred Fluffy_Pillow 133.4/150: 89% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
3:10.943 shred Fluffy_Pillow 146.1/150: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
3:11.947 healing_touch Fluffy_Pillow 138.7/150: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
3:12.746 savage_roar Fluffy_Pillow 148.8/150: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, leeching_pestilence, blood_frenzy
3:13.749 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, leeching_pestilence, blood_frenzy
3:14.753 rake Fluffy_Pillow 142.6/150: 95% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy
3:15.757 shred Fluffy_Pillow 137.8/150: 92% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy
3:16.762 shred Fluffy_Pillow 130.5/150: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy
3:17.766 healing_touch Fluffy_Pillow 121.9/150: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:18.665 ferocious_bite Fluffy_Pillow 132.0/150: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:19.669 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:20.675 shred Fluffy_Pillow 81.2/100: 81% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
3:21.680 shred Fluffy_Pillow 92.5/100: 92% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:22.686 shred Fluffy_Pillow 63.7/100: 64% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:23.691 healing_touch Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:24.589 Waiting 1.800 sec 45.0/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:26.389 rip Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:27.395 rake Fluffy_Pillow 46.4/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:28.400 Waiting 1.611 sec 22.6/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:30.011 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:31.015 Waiting 2.373 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:33.388 lunar_inspiration Fluffy_Pillow 38.4/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:34.392 tigers_fury Fluffy_Pillow 19.6/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:34.392 healing_touch Fluffy_Pillow 79.6/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:35.290 rip Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
3:36.294 rake Fluffy_Pillow 85.9/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:37.301 shred Fluffy_Pillow 77.2/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:38.307 shred Fluffy_Pillow 63.4/100: 63% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
3:39.310 healing_touch Fluffy_Pillow 34.6/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, jacins_ruse
3:40.209 savage_roar Fluffy_Pillow 44.7/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), tigers_fury, jacins_ruse
3:41.213 rake Fluffy_Pillow 55.9/100: 56% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:42.217 shred Fluffy_Pillow 67.1/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:43.223 Waiting 0.200 sec 38.4/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:43.423 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:44.428 Waiting 2.575 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:47.003 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:48.008 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:48.908 Waiting 3.872 sec 22.0/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:52.780 rip Fluffy_Pillow 65.3/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
3:53.785 rake Fluffy_Pillow 76.5/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:54.790 lunar_inspiration Fluffy_Pillow 52.7/100: 53% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:55.794 Waiting 0.600 sec 34.0/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:56.394 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:57.396 shred Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
3:58.401 healing_touch Fluffy_Pillow 23.1/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:59.299 Waiting 2.100 sec 33.1/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:01.399 savage_roar Fluffy_Pillow 56.6/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:02.404 ashamanes_frenzy Fluffy_Pillow 27.9/100: 28% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
4:03.408 rake Fluffy_Pillow 39.2/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:04.412 tigers_fury Fluffy_Pillow 16.8/100: 17% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:04.412 use_item_ravaged_seed_pod Fluffy_Pillow 76.8/100: 77% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:04.412 shred Fluffy_Pillow 76.8/100: 77% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, jacins_ruse
4:05.416 healing_touch Fluffy_Pillow 64.4/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, jacins_ruse
4:06.213 rip Fluffy_Pillow 74.5/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, jacins_ruse
4:07.218 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, jacins_ruse
4:08.221 rake Fluffy_Pillow 97.6/100: 98% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, jacins_ruse
4:09.227 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, jacins_ruse
4:10.231 shred Fluffy_Pillow 72.6/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, jacins_ruse
4:11.236 healing_touch Fluffy_Pillow 45.3/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, jacins_ruse
4:12.034 Waiting 2.600 sec 55.4/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, jacins_ruse
4:14.634 ferocious_bite Fluffy_Pillow 88.1/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
4:15.639 rake Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:16.642 shred Fluffy_Pillow 63.4/100: 63% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:17.647 Waiting 0.400 sec 36.1/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:18.047 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:19.051 Waiting 0.991 sec 13.8/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:20.042 lunar_inspiration Fluffy_Pillow 26.3/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
4:21.046 healing_touch Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:21.844 Waiting 3.500 sec 49.0/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
4:25.344 rip Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:26.347 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:27.349 shred Fluffy_Pillow 76.2/100: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:28.353 shred Fluffy_Pillow 47.4/100: 47% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, jacins_ruse
4:29.357 healing_touch Fluffy_Pillow 18.7/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, jacins_ruse
4:31.281 savage_roar Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
4:33.309 rake Fluffy_Pillow 22.9/100: 23% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
4:34.313 tigers_fury Fluffy_Pillow 34.1/100: 34% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:34.412 lunar_inspiration Fluffy_Pillow 95.2/100: 95% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:35.417 shred Fluffy_Pillow 91.4/100: 91% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:36.421 shred Fluffy_Pillow 77.6/100: 78% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:37.425 healing_touch Fluffy_Pillow 63.9/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:38.323 Waiting 1.400 sec 73.9/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
4:39.723 rip Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
4:40.728 shadowmeld Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:40.728 rake Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:40.728 auto_attack Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:41.730 shred Fluffy_Pillow 47.0/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
4:42.736 Waiting 2.002 sec 18.3/100: 18% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:44.738 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:45.744 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:46.642 Waiting 2.073 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:48.715 savage_roar Fluffy_Pillow 45.1/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:49.719 lunar_inspiration Fluffy_Pillow 56.3/100: 56% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:50.722 Waiting 0.300 sec 37.6/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:51.022 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:52.027 Waiting 1.848 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:54.131 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:55.136 Waiting 2.569 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:57.705 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:58.711 shred Fluffy_Pillow 13.3/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
4:59.717 healing_touch Fluffy_Pillow 26.0/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:00.516 rip Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:03.056 rake Fluffy_Pillow 38.1/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:04.062 lunar_inspiration Fluffy_Pillow 15.7/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:05.067 tigers_fury Fluffy_Pillow 28.4/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:05.067 use_item_ravaged_seed_pod Fluffy_Pillow 88.4/100: 88% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:05.067 shred Fluffy_Pillow 88.4/100: 88% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
5:06.072 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
5:06.870 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
5:07.874 rake Fluffy_Pillow 97.6/100: 98% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
5:08.879 shred Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:09.883 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:10.886 shred Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:11.888 healing_touch Fluffy_Pillow 42.4/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:12.785 Waiting 2.300 sec 52.5/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
5:15.085 savage_roar Fluffy_Pillow 78.2/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:16.089 rake Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:17.093 lunar_inspiration Fluffy_Pillow 65.6/100: 66% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:18.097 ashamanes_frenzy Fluffy_Pillow 46.9/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:19.102 healing_touch Fluffy_Pillow 58.1/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:20.001 Waiting 1.900 sec 68.1/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:21.901 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:22.904 rake Fluffy_Pillow 71.5/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:23.910 shred Fluffy_Pillow 49.2/100: 49% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:24.914 Waiting 0.551 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:25.465 shred Fluffy_Pillow 28.8/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:26.473 shred Fluffy_Pillow 41.5/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:27.478 healing_touch Fluffy_Pillow 14.1/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:28.277 Waiting 3.800 sec 24.2/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:32.077 ferocious_bite Fluffy_Pillow 72.1/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
5:33.083 rake Fluffy_Pillow 58.6/100: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:34.089 lunar_inspiration Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:35.094 tigers_fury Fluffy_Pillow 18.9/100: 19% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:35.094 shred Fluffy_Pillow 78.9/100: 79% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:36.099 shred Fluffy_Pillow 66.6/100: 67% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:37.103 shred Fluffy_Pillow 54.2/100: 54% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:38.107 healing_touch Fluffy_Pillow 41.9/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:38.904 Waiting 0.900 sec 51.9/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
5:39.804 ferocious_bite Fluffy_Pillow 63.3/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
5:41.575 rake Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:42.580 Waiting 1.533 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:44.113 lunar_inspiration Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
5:45.116 Waiting 2.534 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
5:47.650 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
5:48.652 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, jacins_ruse
5:51.333 savage_roar Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
5:52.337 rake Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:53.341 Waiting 1.500 sec 24.3/100: 24% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:54.841 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:55.845 Waiting 1.236 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:57.081 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:58.085 Waiting 1.731 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:59.816 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:00.821 Waiting 2.578 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:03.399 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:04.404 Waiting 1.172 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:05.576 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:05.576 berserk Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:05.576 use_item_ravaged_seed_pod Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
6:05.576 potion Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
6:05.576 rake Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:06.582 shred Fluffy_Pillow 93.7/150: 62% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:07.587 healing_touch Fluffy_Pillow 100.0/150: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:08.486 rip Fluffy_Pillow 110.0/150: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:09.491 rake Fluffy_Pillow 121.3/150: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:10.496 shred Fluffy_Pillow 115.0/150: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:11.502 shred Fluffy_Pillow 106.3/150: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:12.508 lunar_inspiration Fluffy_Pillow 98.9/150: 66% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:13.515 shred Fluffy_Pillow 96.6/150: 64% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:14.519 healing_touch Fluffy_Pillow 89.3/150: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:15.316 savage_roar Fluffy_Pillow 99.3/150: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:16.320 rake Fluffy_Pillow 112.0/150: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:17.324 shred Fluffy_Pillow 107.1/150: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:18.329 shred Fluffy_Pillow 99.8/150: 67% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:19.333 healing_touch Fluffy_Pillow 92.4/150: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:20.132 ferocious_bite Fluffy_Pillow 102.5/150: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, blood_frenzy, potion_of_the_old_war
6:21.136 shred Fluffy_Pillow 90.1/100: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:22.142 shred Fluffy_Pillow 61.9/100: 62% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:23.148 Waiting 0.700 sec 33.2/100: 33% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:23.848 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:24.852 Waiting 1.544 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:26.396 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:27.399 healing_touch Fluffy_Pillow 13.4/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:28.197 Waiting 1.322 sec 23.5/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:29.519 savage_roar Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:30.525 rake Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:31.527 Waiting 1.200 sec 25.4/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
6:32.727 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
6:33.732 Waiting 1.637 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
6:35.369 tigers_fury Fluffy_Pillow 33.8/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
6:35.576 shred Fluffy_Pillow 96.4/100: 96% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
6:36.580 healing_touch Fluffy_Pillow 84.1/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
6:37.377 ferocious_bite Fluffy_Pillow 94.1/100: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
6:38.382 ashamanes_frenzy Fluffy_Pillow 96.8/100: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
6:39.387 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:40.391 healing_touch Fluffy_Pillow 72.6/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:41.188 Waiting 0.400 sec 82.7/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
6:41.588 ferocious_bite Fluffy_Pillow 87.7/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
6:42.591 shadowmeld Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:42.591 rake Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:42.591 auto_attack Fluffy_Pillow 15.4/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:43.595 Waiting 0.200 sec 28.0/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:43.795 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:44.798 Waiting 2.138 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:46.936 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:47.941 Waiting 1.870 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:49.811 shred Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
6:50.815 healing_touch Fluffy_Pillow 47.5/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:51.714 savage_roar Fluffy_Pillow 57.5/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:53.487 rake Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:54.492 Waiting 1.519 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
6:56.011 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
6:59.311 rake Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
7:00.316 Waiting 1.008 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:01.324 ferocious_bite Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
7:02.329 Waiting 2.630 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:04.959 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:05.963 tigers_fury Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:05.963 use_item_ravaged_seed_pod Fluffy_Pillow 71.9/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:05.963 shred Fluffy_Pillow 71.9/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:06.967 shred Fluffy_Pillow 58.1/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:07.971 lunar_inspiration Fluffy_Pillow 44.3/100: 44% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:08.977 healing_touch Fluffy_Pillow 70.6/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:09.874 Waiting 0.800 sec 80.6/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
7:10.674 ferocious_bite Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
7:11.677 rake Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:12.682 Waiting 1.200 sec 27.0/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:13.882 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:14.887 Waiting 1.692 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, leeching_pestilence
7:16.579 shred Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
7:17.584 shred Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:18.587 healing_touch Fluffy_Pillow 13.0/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:19.486 Waiting 1.570 sec 23.1/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:21.056 savage_roar Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:24.366 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:25.370 Waiting 1.393 sec 13.9/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:26.763 lunar_inspiration Fluffy_Pillow 30.0/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
7:27.767 Waiting 2.179 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
7:29.946 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 23361 21655 11591 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 28033 25986 0
Crit 33.77% 33.77% 6220
Haste 11.82% 11.82% 3842
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 23361 21655 0
Mastery 51.70% 49.54% 5871
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 849.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Bloodthirsty Instinct
ilevel: 880, stats: { +1631 Agi }
Local Trinket2 Ravaged Seed Pod
ilevel: 880, stats: { +1043 Haste }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="instinct_880 / pod_880"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1806
trinket2=ravaged_seed_pod,id=139320,bonus_id=1806
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=848.75
# gear_agility=11591
# gear_stamina=17628
# gear_crit_rating=6220
# gear_haste_rating=2561
# gear_mastery_rating=5871
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

pod_880 / call_880 : 311919 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
311918.7 311918.7 393.3 / 0.126% 39843.9 / 12.8% 20568.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.2 15.2 Energy 30.20% 44.9 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
pod_880 / call_880 311919
Ashamane's Frenzy 14426 4.6% 6.1 78.51sec 1061291 1056566 Direct 91.5 9736 19466 13206 35.7%  
Periodic 30.2 128778 257573 174693 35.6% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.12 91.50 121.73 30.24 1.0045 0.6471 6490482.91 7058511.33 8.05 76433.26 1056565.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.87 64.34% 9736.48 7173 12564 9738.31 8796 10877 573196 842653 31.98
crit 32.63 35.66% 19465.97 14346 25129 19468.69 17570 21773 635131 933703 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.5 64.36% 128778.25 79089 173165 128794.43 114373 145574 2506021 2506021 0.00
crit 10.8 35.64% 257573.34 162132 346330 257642.17 222038 300830 2776135 2776135 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 36702 11.8% 19.0 22.46sec 868963 0 Periodic 149.8 81596 163008 110354 35.3% 42.9%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.02 0.00 149.78 149.78 0.0000 1.2901 16529419.75 16529419.75 0.00 85539.18 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.9 64.67% 81595.73 56 104891 81503.59 71337 89417 7904220 7904220 0.00
crit 52.9 35.33% 163008.21 112 209782 162789.94 137310 183066 8625200 8625200 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 29064 9.3% 528.4 0.85sec 24740 29118 Direct 528.4 18260 36514 24740 35.5%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 528.41 528.41 0.00 0.00 0.8496 0.0000 13072704.39 19218113.73 31.98 29118.07 29118.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 340.84 64.50% 18260.15 14216 20436 18259.78 17859 18530 6223712 9149445 31.98
crit 187.57 35.50% 36513.77 28433 40872 36513.00 35652 37384 6848993 10068668 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 7013 2.2% 11.3 41.60sec 279272 278037 Direct 11.3 194828 434157 279266 35.3%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.28 11.28 0.00 0.00 1.0045 0.0000 3149880.75 4630623.06 31.98 278036.96 278036.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.30 64.71% 194827.67 14769 251221 194748.78 105789 243029 1421979 2090443 31.98
crit 3.98 35.29% 434157.42 33634 555198 428369.78 0 555198 1727902 2540180 31.71
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Infested Ground 6148 2.0% 7.9 60.68sec 352031 0 Direct 77.6 26297 52608 35617 35.4%  

Stats details: infested_ground

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.85 77.62 0.00 0.00 0.0000 0.0000 2764692.64 2764692.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.12 64.57% 26297.02 19237 27653 26297.28 24975 27079 1318019 1318019 0.00
crit 27.50 35.43% 52608.03 38474 55306 52611.62 48805 54945 1446674 1446674 0.00
 
 

Action details: infested_ground

Static Values
  • id:221803
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221803
  • name:Infested Ground
  • school:shadow
  • tooltip:
  • description:Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.
 
Moonfire (lunar_inspiration) 23159 7.4% 31.7 14.31sec 328958 327484 Direct 31.7 33033 66100 44748 35.4%  
Periodic 259.9 25567 51131 34634 35.5% 97.1%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.67 31.67 259.87 259.87 1.0045 1.6809 10417268.25 10417268.25 0.00 22229.72 327484.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.45 64.57% 33033.37 25727 36982 33032.89 30953 35173 675498 675498 0.00
crit 11.22 35.43% 66099.55 51454 73964 66088.60 58600 71821 741533 741533 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 167.7 64.53% 25566.51 99 28764 25566.65 24888 26143 4287471 4287471 0.00
crit 92.2 35.47% 51131.10 85 57529 51132.69 49153 52793 4712766 4712766 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2279 0.7% 25.2 17.76sec 40735 0 Periodic 74.3 13791 0 13791 0.0% 8.2%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.15 0.00 74.29 74.29 0.0000 0.4970 1024542.14 1506174.00 31.98 27748.83 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.3 100.00% 13790.56 27 15493 13791.04 12905 14535 1024542 1506174 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11694 3.7% 24.5 16.70sec 212052 0 Direct 24.5 156853 313504 212073 35.2%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.48 24.48 0.00 0.00 0.0000 0.0000 5191847.11 7632507.03 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.86 64.76% 156852.57 122075 175482 156827.60 143160 168615 2487089 3656256 31.98
crit 8.63 35.24% 313503.55 244149 350964 313482.17 244149 350964 2704758 3976251 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 68782 22.1% 47.5 9.49sec 651113 648206 Direct 47.5 83544 167012 113081 35.4%  
Periodic 223.7 84327 168636 114293 35.5% 95.1%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.53 47.53 223.73 223.73 1.0045 1.9133 30944694.91 30944694.91 0.00 65037.19 648205.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.71 64.61% 83544.10 38782 203794 83569.21 72603 95894 2565396 2565396 0.00
crit 16.82 35.39% 167012.01 77565 407588 166979.60 127599 217950 2808865 2808865 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 144.2 64.46% 84326.81 36 203794 84350.48 74958 94260 12160396 12160396 0.00
crit 79.5 35.54% 168636.44 72 407588 168677.01 143771 193450 13410038 13410038 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 82597 26.5% 23.1 15.32sec 1612481 1605326 Periodic 327.2 83818 167592 113622 35.6% 96.4%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.06 0.00 327.25 327.25 1.0045 1.3257 37182550.54 37182550.54 0.00 81365.28 1605325.56
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 210.8 64.42% 83817.64 56 104891 83808.59 78250 88816 17670706 17670706 0.00
crit 116.4 35.58% 167591.82 129 209782 167566.65 150230 177443 19511844 19511844 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 30055 9.6% 112.4 3.99sec 120204 119666 Direct 112.4 88615 177499 120206 35.5%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.37 112.37 0.00 0.00 1.0045 0.0000 13507409.30 19857171.13 31.98 119665.91 119665.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.44 64.46% 88615.14 61977 133637 88629.34 82847 94687 6418877 9436357 31.98
crit 39.94 35.54% 177499.13 123954 267275 177452.95 164096 198358 7088532 10420814 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
pod_880 / call_880
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:pod_880 / call_880
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.04sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Cleansed Drake's Breath 4.3 79.89sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.25 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:pod_880 / call_880
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:pod_880 / call_880
  • harmful:false
  • if_expr:
 
Healing Touch 51.5 8.84sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 51.48 0.00 0.00 0.00 0.8463 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.7 24.52sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.73 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.03sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.34sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.18% 45.4(45.4) 15.1

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 14.66% 0.0(0.0) 2.9

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.45% 0.0(0.0) 1.0

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 51.5 0.0 8.8sec 8.8sec 45.98% 46.01% 0.0(0.0) 0.0

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.58%
  • bloodtalons_2:27.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Cleansed Ancient's Blessing 4.0 0.3 87.2sec 78.8sec 9.08% 9.18% 0.3(0.3) 3.9

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_ancients_blessing_1:9.08%

Trigger Attempt Success

  • trigger_pct:98.60%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 3.9 0.3 88.3sec 79.8sec 8.88% 8.98% 0.3(0.3) 3.8

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_sisters_blessing_1:8.88%

Trigger Attempt Success

  • trigger_pct:98.76%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 3.9 0.3 87.6sec 78.7sec 9.06% 9.16% 0.3(0.3) 3.9

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2878.11

Stack Uptimes

  • cleansed_wisps_blessing_1:9.06%

Trigger Attempt Success

  • trigger_pct:98.55%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Clearcasting 44.7 1.5 9.9sec 9.6sec 6.61% 15.34% 1.5(1.5) 0.0

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.61%

Trigger Attempt Success

  • trigger_pct:8.75%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.8 64.1sec 48.6sec 24.60% 24.69% 1.8(1.8) 6.4

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Leeching Pestilence 7.9 0.0 60.7sec 60.7sec 17.28% 17.37% 0.0(0.0) 7.7

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_leeching_pestilence
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:leech_rating
  • amount:2037.36

Stack Uptimes

  • leeching_pestilence_1:17.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221805
  • name:Leeching Pestilence
  • tooltip:Leech increased by $w1.
  • description:{$@spelldesc221803=Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.1sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 51.2 1.2 8.8sec 8.6sec 74.44% 74.46% 1.2(1.2) 0.0

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.44%

Trigger Attempt Success

  • trigger_pct:98.65%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 7.7 11.0 50.4sec 24.5sec 93.99% 93.72% 201.9(201.9) 6.7

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.0sec 133.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.80% 28.98% 0.0(0.0) 14.9

Buff details

  • buff initial source:pod_880 / call_880
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
pod_880 / call_880
ferocious_bite Energy 22.6 386.6 17.1 34.3 8147.0
ferocious_bite Combo Points 11.3 52.9 4.7 4.7 59592.6
lunar_inspiration Energy 31.7 784.5 24.8 24.8 13279.4
rake Energy 47.5 1353.7 28.5 28.5 22858.6
rip Energy 23.1 466.1 20.2 20.2 79780.4
rip Combo Points 23.1 115.3 5.0 5.0 322491.5
savage_roar Energy 18.7 481.3 25.7 25.7 0.0
savage_roar Combo Points 18.7 93.6 5.0 5.0 0.0
shred Energy 112.4 3347.7 29.8 29.8 4034.9
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.53 47.53 (17.93%) 1.00 0.00 0.00%
tigers_fury Energy 15.21 911.78 (10.97%) 59.96 0.57 0.06%
ashamanes_frenzy Combo Points 6.12 18.35 (6.92%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.67 31.67 (11.95%) 1.00 0.00 0.00%
shred Combo Points 112.37 112.37 (42.41%) 1.00 0.00 0.00%
energy_regen Energy 2099.43 5213.92 (62.75%) 2.48 77.95 1.47%
clearcasting Energy 44.62 1522.37 (18.32%) 34.12 0.00 0.00%
ashamanes_energy Energy 45.42 661.11 (7.96%) 14.56 20.16 2.96%
primal_fury Combo Points 67.98 55.08 (20.79%) 0.81 12.90 18.97%
Resource RPS-Gain RPS-Loss
Energy 15.08 15.16
Combo Points 0.59 0.58
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 35.83 0.03 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.22 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.9%

Procs

Count Interval
clearcasting 46.2 9.6sec
clearcasting_wasted 1.5 120.5sec
primal_fury 68.0 6.6sec

Statistics & Data Analysis

Fight Length
Sample Data pod_880 / call_880 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data pod_880 / call_880 Damage Per Second
Count 2499
Mean 311918.68
Minimum 280178.47
Maximum 347396.69
Spread ( max - min ) 67218.22
Range [ ( max - min ) / 2 * 100% ] 10.77%
Standard Deviation 10030.5261
5th Percentile 295320.23
95th Percentile 328587.43
( 95th Percentile - 5th Percentile ) 33267.20
Mean Distribution
Standard Deviation 200.6507
95.00% Confidence Intervall ( 311525.41 - 312311.95 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3972
0.1 Scale Factor Error with Delta=300 858877
0.05 Scale Factor Error with Delta=300 3435508
0.01 Scale Factor Error with Delta=300 85887723
Priority Target DPS
Sample Data pod_880 / call_880 Priority Target Damage Per Second
Count 2499
Mean 311918.68
Minimum 280178.47
Maximum 347396.69
Spread ( max - min ) 67218.22
Range [ ( max - min ) / 2 * 100% ] 10.77%
Standard Deviation 10030.5261
5th Percentile 295320.23
95th Percentile 328587.43
( 95th Percentile - 5th Percentile ) 33267.20
Mean Distribution
Standard Deviation 200.6507
95.00% Confidence Intervall ( 311525.41 - 312311.95 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3972
0.1 Scale Factor Error with Delta=300 858877
0.05 Scale Factor Error with Delta=300 3435508
0.01 Scale Factor Error with Delta=300 85887723
DPS(e)
Sample Data pod_880 / call_880 Damage Per Second (Effective)
Count 2499
Mean 311918.68
Minimum 280178.47
Maximum 347396.69
Spread ( max - min ) 67218.22
Range [ ( max - min ) / 2 * 100% ] 10.77%
Damage
Sample Data pod_880 / call_880 Damage
Count 2499
Mean 140275492.71
Minimum 106271755.39
Maximum 177106321.00
Spread ( max - min ) 70834565.61
Range [ ( max - min ) / 2 * 100% ] 25.25%
DTPS
Sample Data pod_880 / call_880 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data pod_880 / call_880 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data pod_880 / call_880 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data pod_880 / call_880 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data pod_880 / call_880 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data pod_880 / call_880 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data pod_880 / call_880Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data pod_880 / call_880 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.58 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.58 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 7.85 use_item,slot=trinket1,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
C 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
D 15.21 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
E 3.79 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
F 50.48 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
J 7.70 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
K 23.06 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
L 11.03 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
M 7.48 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
N 6.12 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
O 3.58 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
P 42.95 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
Q 31.67 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
R 112.37 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789QRDABRJRFNKRRPQFMPRRFKRRRRFLPQPDRRFKO89RRQFLRRRPQFKPRRDBRFKPQRRFJPRRQRFKNRPFDKPQRFJRPRFKPQRFLPRDBQRFKPRRRFLPQRFKPRRRFMDPQRFKPRRRFJNPQFKPRRQDABFKO89RRRFLRRRRFMQRPFKPRQFLDPRRRFKPQRRFKPRQRFDBPJNRFKPQRRFLPRRRQFKPDRRFKPQRRFJPQPRFKPDBRRRQFKO89RRRFQJNPFKRRRDRFKPQRRFLPQRRFEPRQDABCRFLPRRERRRRRFMPQRRFLPQPDRERRRFMNPQFLPRQEDBRRRRFLO89QRFEPRR

Sample Sequence Table

time name target resources buffs
Pre flask pod_880 / call_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food pod_880 / call_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation pod_880 / call_880 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 76.8/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, cleansed_wisps_blessing, potion_of_the_old_war
0:02.011 shred Fluffy_Pillow 61.7/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, cleansed_wisps_blessing, potion_of_the_old_war
0:03.018 tigers_fury Fluffy_Pillow 36.5/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, cleansed_wisps_blessing, potion_of_the_old_war
0:03.018 berserk Fluffy_Pillow 96.5/100: 97% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:03.018 use_item_ravaged_seed_pod Fluffy_Pillow 96.5/150: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, cleansed_wisps_blessing, potion_of_the_old_war
0:03.018 shred Fluffy_Pillow 96.5/150: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, potion_of_the_old_war
0:04.023 savage_roar Fluffy_Pillow 106.3/150: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, potion_of_the_old_war
0:05.027 shred Fluffy_Pillow 116.1/150: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, potion_of_the_old_war
0:06.031 healing_touch Fluffy_Pillow 125.9/150: 84% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, potion_of_the_old_war
0:06.785 ashamanes_frenzy Fluffy_Pillow 137.1/150: 91% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, potion_of_the_old_war
0:07.789 rip Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons, berserk, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, potion_of_the_old_war
0:08.793 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, potion_of_the_old_war
0:09.798 shred Fluffy_Pillow 144.8/150: 97% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, potion_of_the_old_war
0:10.803 rake Fluffy_Pillow 139.6/150: 93% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:11.807 lunar_inspiration Fluffy_Pillow 136.9/150: 91% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
0:12.811 healing_touch Fluffy_Pillow 136.7/150: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
0:13.565 ferocious_bite Fluffy_Pillow 147.9/150: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
0:14.569 rake Fluffy_Pillow 137.7/150: 92% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:15.576 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.580 shred Fluffy_Pillow 144.8/150: 97% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.584 healing_touch Fluffy_Pillow 139.6/150: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:18.338 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, jacins_ruse, potion_of_the_old_war
0:19.342 shred Fluffy_Pillow 84.8/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:20.348 shred Fluffy_Pillow 59.6/100: 60% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:21.353 shred Fluffy_Pillow 34.5/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:22.359 shred Fluffy_Pillow 49.3/100: 49% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:23.363 healing_touch Fluffy_Pillow 24.1/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:24.117 Waiting 2.100 sec 35.2/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, jacins_ruse
0:26.217 savage_roar Fluffy_Pillow 66.2/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, jacins_ruse
0:27.222 rake Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
0:28.227 Waiting 0.683 sec 20.8/100: 21% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:28.910 lunar_inspiration Fluffy_Pillow 30.9/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:29.915 Waiting 0.830 sec 15.7/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:31.257 rake Fluffy_Pillow 35.5/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:32.259 Waiting 0.659 sec 15.3/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:32.918 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:33.018 shred Fluffy_Pillow 86.5/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.022 shred Fluffy_Pillow 76.3/100: 76% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.027 healing_touch Fluffy_Pillow 66.1/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.781 rip Fluffy_Pillow 77.2/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:36.788 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:36.788 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:36.788 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:37.793 shred Fluffy_Pillow 79.8/100: 80% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:38.797 shred Fluffy_Pillow 54.6/100: 55% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.801 Waiting 0.100 sec 29.4/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.901 lunar_inspiration Fluffy_Pillow 30.9/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:40.905 healing_touch Fluffy_Pillow 15.7/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:41.856 Waiting 1.000 sec 26.5/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:42.856 savage_roar Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:43.862 shred Fluffy_Pillow 49.2/100: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:44.866 Waiting 0.384 sec 20.6/100: 21% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
0:45.250 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
0:46.253 Waiting 0.400 sec 36.4/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:46.653 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:47.658 Waiting 2.219 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:49.877 rake Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:50.882 Waiting 1.980 sec 13.9/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:52.862 lunar_inspiration Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:53.868 healing_touch Fluffy_Pillow 17.7/100: 18% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:54.754 Waiting 0.600 sec 27.8/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:55.354 rip Fluffy_Pillow 34.6/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:58.147 rake Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
0:59.154 Waiting 1.984 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:01.138 shred Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
1:02.142 shred Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:03.147 tigers_fury Fluffy_Pillow 18.0/100: 18% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:03.147 use_item_ravaged_seed_pod Fluffy_Pillow 78.0/100: 78% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:03.147 shred Fluffy_Pillow 78.0/100: 78% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:04.151 healing_touch Fluffy_Pillow 64.4/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:05.036 Waiting 0.200 sec 74.4/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
1:05.236 rip Fluffy_Pillow 91.7/100: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
1:06.240 rake Fluffy_Pillow 88.1/100: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:07.244 lunar_inspiration Fluffy_Pillow 64.5/100: 64% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:08.249 shred Fluffy_Pillow 45.9/100: 46% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:09.253 Waiting 2.083 sec 17.3/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:11.336 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, leeching_pestilence
1:12.340 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, leeching_pestilence
1:13.227 Waiting 0.835 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:14.321 savage_roar Fluffy_Pillow 34.7/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), jacins_ruse
1:15.324 rake Fluffy_Pillow 46.1/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
1:16.328 Waiting 1.520 sec 22.5/100: 23% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:17.848 shred Fluffy_Pillow 39.7/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:18.853 shred Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:19.857 Waiting 1.017 sec 22.5/100: 23% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:20.874 lunar_inspiration Fluffy_Pillow 34.1/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:21.879 Waiting 1.240 sec 15.5/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:23.119 shred Fluffy_Pillow 29.5/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
1:24.124 healing_touch Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:25.010 Waiting 1.200 sec 51.0/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:26.210 rip Fluffy_Pillow 64.6/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:27.215 ashamanes_frenzy Fluffy_Pillow 46.0/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:28.219 shred Fluffy_Pillow 57.4/100: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:29.989 rake Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:30.994 healing_touch Fluffy_Pillow 13.9/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:31.881 Waiting 1.100 sec 23.9/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:32.981 tigers_fury Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:33.147 rip Fluffy_Pillow 98.3/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:34.151 rake Fluffy_Pillow 94.7/100: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.154 lunar_inspiration Fluffy_Pillow 86.0/100: 86% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:36.160 shred Fluffy_Pillow 82.5/100: 82% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:37.165 healing_touch Fluffy_Pillow 53.9/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:38.052 Waiting 0.300 sec 63.9/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
1:38.352 savage_roar Fluffy_Pillow 67.3/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, cleansed_ancients_blessing, jacins_ruse
1:39.356 Waiting 0.200 sec 38.7/100: 39% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
1:39.556 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
1:42.608 rake Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:43.614 Waiting 2.545 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:46.159 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:47.163 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:48.048 rip Fluffy_Pillow 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
1:49.307 rake Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:50.309 Waiting 1.563 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:51.872 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:52.879 Waiting 2.537 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:55.416 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:56.419 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:57.305 Waiting 2.938 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:00.243 savage_roar Fluffy_Pillow 59.3/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse
2:01.247 rake Fluffy_Pillow 32.0/100: 32% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:02.251 shred Fluffy_Pillow 44.7/100: 45% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:03.257 tigers_fury Fluffy_Pillow 17.5/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:03.257 use_item_ravaged_seed_pod Fluffy_Pillow 77.5/100: 77% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
2:03.257 lunar_inspiration Fluffy_Pillow 77.5/100: 77% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_sisters_blessing, jacins_ruse
2:04.264 shred Fluffy_Pillow 75.2/100: 75% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_sisters_blessing, jacins_ruse
2:05.268 healing_touch Fluffy_Pillow 63.0/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_sisters_blessing, jacins_ruse
2:06.062 Waiting 0.200 sec 73.0/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence, cleansed_sisters_blessing, jacins_ruse
2:06.262 rip Fluffy_Pillow 90.6/100: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, cleansed_sisters_blessing, jacins_ruse
2:07.266 rake Fluffy_Pillow 73.3/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_sisters_blessing, jacins_ruse
2:08.271 shred Fluffy_Pillow 50.0/100: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:09.276 Waiting 0.320 sec 21.4/100: 21% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:09.596 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:10.600 Waiting 0.400 sec 36.4/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:11.000 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:12.006 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
2:12.893 Waiting 3.030 sec 22.4/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, leeching_pestilence, jacins_ruse
2:15.923 savage_roar Fluffy_Pillow 56.8/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:16.928 rake Fluffy_Pillow 68.2/100: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:17.931 lunar_inspiration Fluffy_Pillow 44.5/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:18.935 shred Fluffy_Pillow 25.9/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
2:19.940 healing_touch Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:20.825 Waiting 3.700 sec 47.4/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:24.525 rip Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
2:25.529 rake Fluffy_Pillow 72.1/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:26.532 shred Fluffy_Pillow 49.8/100: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:27.535 shred Fluffy_Pillow 22.5/100: 22% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:28.539 Waiting 0.400 sec 35.2/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:28.939 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:29.944 healing_touch Fluffy_Pillow 13.0/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:30.739 Waiting 2.152 sec 23.1/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
2:32.891 ferocious_bite Fluffy_Pillow 50.3/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
2:33.895 tigers_fury Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:33.895 rake Fluffy_Pillow 73.1/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:34.899 lunar_inspiration Fluffy_Pillow 65.3/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:35.904 shred Fluffy_Pillow 61.7/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:36.907 healing_touch Fluffy_Pillow 48.1/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
2:37.793 Waiting 2.700 sec 58.1/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:40.493 rip Fluffy_Pillow 88.7/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:41.498 rake Fluffy_Pillow 70.1/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:42.501 shred Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:43.507 shred Fluffy_Pillow 17.9/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
2:44.512 shred Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
2:45.517 healing_touch Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:46.403 Waiting 0.800 sec 50.8/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:47.203 savage_roar Fluffy_Pillow 59.8/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
2:48.208 ashamanes_frenzy Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:49.213 rake Fluffy_Pillow 42.6/100: 43% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:50.221 Waiting 1.023 sec 19.1/100: 19% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:51.244 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:52.248 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:53.133 Waiting 4.056 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:57.189 rip Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse
2:58.193 rake Fluffy_Pillow 53.7/100: 54% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:59.197 shred Fluffy_Pillow 66.4/100: 66% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
3:00.201 Waiting 0.100 sec 39.1/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
3:00.301 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
3:01.305 Waiting 1.340 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
3:02.645 lunar_inspiration Fluffy_Pillow 30.1/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
3:03.650 tigers_fury Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
3:03.895 berserk Fluffy_Pillow 75.9/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
3:03.895 use_item_ravaged_seed_pod Fluffy_Pillow 75.9/150: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
3:03.895 healing_touch Fluffy_Pillow 75.9/150: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_sisters_blessing, jacins_ruse
3:04.689 rip Fluffy_Pillow 86.0/150: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence, cleansed_sisters_blessing, jacins_ruse
3:05.693 shadowmeld Fluffy_Pillow 97.8/150: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:05.693 rake Fluffy_Pillow 97.8/150: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:05.693 auto_attack Fluffy_Pillow 80.3/150: 54% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:06.698 shred Fluffy_Pillow 106.7/150: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:07.703 shred Fluffy_Pillow 113.1/150: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:08.708 shred Fluffy_Pillow 104.5/150: 70% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:09.712 healing_touch Fluffy_Pillow 95.9/150: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:10.597 savage_roar Fluffy_Pillow 106.0/150: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, cleansed_ancients_blessing, jacins_ruse
3:11.603 shred Fluffy_Pillow 97.4/150: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_ancients_blessing, jacins_ruse
3:12.607 shred Fluffy_Pillow 88.8/150: 59% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, leeching_pestilence, cleansed_ancients_blessing, jacins_ruse
3:13.611 shred Fluffy_Pillow 80.2/150: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence, cleansed_ancients_blessing, jacins_ruse
3:14.616 shred Fluffy_Pillow 71.6/150: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
3:15.621 healing_touch Fluffy_Pillow 82.9/150: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
3:16.508 ferocious_bite Fluffy_Pillow 93.0/150: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, cleansed_ancients_blessing, jacins_ruse
3:17.512 lunar_inspiration Fluffy_Pillow 79.4/150: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
3:18.516 shred Fluffy_Pillow 75.8/150: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
3:19.520 rake Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
3:20.524 healing_touch Fluffy_Pillow 43.6/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:21.410 Waiting 3.100 sec 53.6/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:24.510 rip Fluffy_Pillow 88.8/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:25.516 rake Fluffy_Pillow 70.2/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:26.520 shred Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:27.525 Waiting 1.519 sec 18.0/100: 18% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:29.044 lunar_inspiration Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:30.047 healing_touch Fluffy_Pillow 16.6/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:30.931 Waiting 1.200 sec 26.6/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:32.131 savage_roar Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:33.647 tigers_fury Fluffy_Pillow 17.4/100: 17% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:33.895 rake Fluffy_Pillow 80.2/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:34.898 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:35.901 shred Fluffy_Pillow 86.4/100: 86% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:36.905 shred Fluffy_Pillow 72.8/100: 73% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
3:37.910 healing_touch Fluffy_Pillow 44.2/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
3:38.796 Waiting 2.900 sec 54.2/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
3:41.696 rip Fluffy_Pillow 87.1/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
3:42.700 rake Fluffy_Pillow 68.5/100: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:43.703 lunar_inspiration Fluffy_Pillow 44.9/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:44.707 Waiting 1.300 sec 26.3/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:46.007 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:47.009 Waiting 2.513 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:49.522 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:50.526 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:51.412 Waiting 0.637 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:52.049 rip Fluffy_Pillow 29.5/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:53.054 rake Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:54.057 Waiting 2.077 sec 17.3/100: 17% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:56.134 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:57.140 Waiting 1.621 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:58.761 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:59.766 Waiting 2.540 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:02.306 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:03.312 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
4:04.198 tigers_fury Fluffy_Pillow 22.3/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2)
4:04.198 use_item_ravaged_seed_pod Fluffy_Pillow 82.3/100: 82% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
4:04.198 rake Fluffy_Pillow 82.3/100: 82% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, leeching_pestilence
4:05.205 savage_roar Fluffy_Pillow 73.8/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, tigers_fury, leeching_pestilence, jacins_ruse
4:06.209 ashamanes_frenzy Fluffy_Pillow 60.1/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
4:07.212 shred Fluffy_Pillow 86.5/100: 87% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
4:08.216 healing_touch Fluffy_Pillow 57.9/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
4:09.102 Waiting 1.700 sec 68.0/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
4:10.802 rip Fluffy_Pillow 87.2/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
4:11.808 rake Fluffy_Pillow 98.7/100: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
4:12.812 lunar_inspiration Fluffy_Pillow 75.0/100: 75% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
4:13.816 shred Fluffy_Pillow 56.4/100: 56% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
4:14.819 Waiting 0.500 sec 27.8/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:15.319 shred Fluffy_Pillow 33.5/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
4:16.324 healing_touch Fluffy_Pillow 44.9/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:17.207 Waiting 1.500 sec 54.9/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
4:18.707 savage_roar Fluffy_Pillow 71.9/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
4:19.713 rake Fluffy_Pillow 83.3/100: 83% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
4:20.718 shred Fluffy_Pillow 94.7/100: 95% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:21.723 shred Fluffy_Pillow 66.1/100: 66% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:22.729 Waiting 0.300 sec 37.5/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:23.029 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:24.035 Waiting 1.616 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:25.651 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:26.656 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:27.541 Waiting 1.555 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:29.096 rip Fluffy_Pillow 39.7/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:31.371 rake Fluffy_Pillow 35.5/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:32.375 Waiting 1.652 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:34.027 tigers_fury Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:34.198 shred Fluffy_Pillow 92.6/100: 93% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:35.201 shred Fluffy_Pillow 79.0/100: 79% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:36.207 healing_touch Fluffy_Pillow 65.4/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:37.093 Waiting 0.200 sec 75.4/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:37.293 rip Fluffy_Pillow 92.7/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:38.296 rake Fluffy_Pillow 74.1/100: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:39.301 lunar_inspiration Fluffy_Pillow 50.5/100: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
4:40.306 Waiting 0.700 sec 31.9/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:41.006 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
4:42.013 Waiting 2.164 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
4:44.177 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:45.180 healing_touch Fluffy_Pillow 12.9/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:45.973 Waiting 3.961 sec 23.0/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
4:49.934 savage_roar Fluffy_Pillow 73.1/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), cleansed_sisters_blessing
4:50.939 rake Fluffy_Pillow 45.9/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:51.944 Waiting 1.109 sec 23.6/100: 24% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:53.053 lunar_inspiration Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:54.057 Waiting 0.364 sec 20.4/100: 20% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:55.443 rake Fluffy_Pillow 37.9/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:56.447 Waiting 2.320 sec 14.6/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:58.767 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:59.772 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:00.658 Waiting 0.536 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:01.194 rip Fluffy_Pillow 28.4/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:02.200 rake Fluffy_Pillow 39.8/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:03.206 Waiting 0.774 sec 16.2/100: 16% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:03.980 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:04.198 use_item_ravaged_seed_pod Fluffy_Pillow 87.5/100: 87% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:04.198 shred Fluffy_Pillow 87.5/100: 87% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:05.203 shred Fluffy_Pillow 73.9/100: 74% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:06.207 shred Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:07.211 lunar_inspiration Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:08.216 healing_touch Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:09.101 Waiting 0.700 sec 68.1/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
5:09.801 rip Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
5:10.806 shadowmeld Fluffy_Pillow 87.4/100: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:10.806 rake Fluffy_Pillow 87.4/100: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:10.806 auto_attack Fluffy_Pillow 52.4/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:11.811 shred Fluffy_Pillow 63.8/100: 64% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
5:12.816 Waiting 0.500 sec 35.2/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, leeching_pestilence
5:13.316 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, leeching_pestilence
5:14.320 Waiting 2.521 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
5:16.841 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
5:17.846 Waiting 2.522 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
5:20.368 healing_touch Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
5:21.254 lunar_inspiration Fluffy_Pillow 50.9/100: 51% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2)
5:23.025 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
5:24.032 ashamanes_frenzy Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:25.035 rake Fluffy_Pillow 23.8/100: 24% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:26.040 healing_touch Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
5:26.924 rip Fluffy_Pillow 45.2/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:27.930 shred Fluffy_Pillow 56.7/100: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:28.935 Waiting 1.100 sec 28.0/100: 28% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:30.035 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:31.039 Waiting 2.553 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:33.592 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:34.595 tigers_fury Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:34.595 shred Fluffy_Pillow 72.2/100: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:35.599 healing_touch Fluffy_Pillow 98.6/100: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:36.484 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:37.489 rake Fluffy_Pillow 96.4/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:38.493 lunar_inspiration Fluffy_Pillow 87.8/100: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
5:39.496 shred Fluffy_Pillow 69.2/100: 69% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:40.501 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:41.505 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:42.392 Waiting 3.663 sec 22.0/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:46.055 savage_roar Fluffy_Pillow 63.6/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:47.315 rake Fluffy_Pillow 37.9/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:48.320 Waiting 0.947 sec 14.2/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:49.267 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:50.273 shred Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:51.278 shred Fluffy_Pillow 47.8/100: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:52.283 healing_touch Fluffy_Pillow 19.2/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:53.168 Waiting 1.300 sec 29.2/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:54.468 ferocious_bite Fluffy_Pillow 44.0/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:57.771 rake Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:58.775 Waiting 2.382 sec 13.9/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:01.157 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:02.159 Waiting 1.625 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:03.784 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:04.788 tigers_fury Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:04.788 berserk Fluffy_Pillow 72.1/100: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:04.788 use_item_ravaged_seed_pod Fluffy_Pillow 72.1/150: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
6:04.788 potion Fluffy_Pillow 72.1/150: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
6:04.788 shred Fluffy_Pillow 72.1/150: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:05.792 healing_touch Fluffy_Pillow 78.4/150: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:06.677 savage_roar Fluffy_Pillow 88.5/150: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:07.680 rake Fluffy_Pillow 94.9/150: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:08.685 shred Fluffy_Pillow 103.8/150: 69% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:09.689 shred Fluffy_Pillow 95.1/150: 63% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:10.692 ferocious_bite Fluffy_Pillow 86.5/150: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:11.697 shred Fluffy_Pillow 72.9/150: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:12.700 shred Fluffy_Pillow 64.3/150: 43% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:13.706 shred Fluffy_Pillow 55.7/150: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:14.711 shred Fluffy_Pillow 47.1/150: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, leeching_pestilence, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:15.716 shred Fluffy_Pillow 58.5/150: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:16.719 healing_touch Fluffy_Pillow 49.9/150: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:17.605 ferocious_bite Fluffy_Pillow 59.9/150: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
6:18.609 rake Fluffy_Pillow 46.3/150: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:19.612 lunar_inspiration Fluffy_Pillow 40.2/150: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:20.616 Waiting 0.400 sec 36.6/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:21.016 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:22.020 Waiting 2.501 sec 12.5/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:24.521 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:25.527 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:26.412 Waiting 0.835 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:27.247 savage_roar Fluffy_Pillow 31.8/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, potion_of_the_old_war
6:28.252 rake Fluffy_Pillow 43.2/100: 43% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, potion_of_the_old_war
6:29.256 Waiting 1.877 sec 19.6/100: 20% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:31.133 lunar_inspiration Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
6:33.414 rake Fluffy_Pillow 36.7/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
6:34.417 Waiting 1.047 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:35.464 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:35.464 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:36.469 ferocious_bite Fluffy_Pillow 71.4/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:37.473 shred Fluffy_Pillow 47.8/100: 48% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:38.479 Waiting 0.600 sec 34.2/100: 34% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
6:39.079 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
6:40.081 Waiting 1.114 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
6:41.195 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
6:42.200 healing_touch Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
6:43.086 Waiting 3.800 sec 46.4/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
6:46.886 ferocious_bite Fluffy_Pillow 89.5/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:47.890 ashamanes_frenzy Fluffy_Pillow 50.9/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:48.895 rake Fluffy_Pillow 62.3/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:49.900 lunar_inspiration Fluffy_Pillow 38.7/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:50.904 healing_touch Fluffy_Pillow 20.1/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:51.789 Waiting 5.200 sec 30.2/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:56.989 savage_roar Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:57.993 rake Fluffy_Pillow 60.5/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:58.999 Waiting 0.300 sec 36.9/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
6:59.299 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:00.303 Waiting 1.669 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:01.972 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:02.976 Waiting 1.841 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:04.817 ferocious_bite Fluffy_Pillow 32.9/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:05.822 tigers_fury Fluffy_Pillow 11.4/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:05.822 use_item_ravaged_seed_pod Fluffy_Pillow 71.4/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:05.822 shred Fluffy_Pillow 71.4/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:06.827 shred Fluffy_Pillow 57.8/100: 58% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:07.832 shred Fluffy_Pillow 84.2/100: 84% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:08.836 shred Fluffy_Pillow 70.6/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:09.840 healing_touch Fluffy_Pillow 42.0/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:10.726 Waiting 1.300 sec 52.0/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
7:12.026 savage_roar Fluffy_Pillow 66.8/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
7:13.033 shadowmeld Fluffy_Pillow 38.2/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:13.033 rake Fluffy_Pillow 38.2/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:13.033 auto_attack Fluffy_Pillow 3.2/100: 3% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:14.039 Waiting 1.416 sec 14.6/100: 15% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, leeching_pestilence, cleansed_ancients_blessing
7:15.455 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, leeching_pestilence, cleansed_ancients_blessing
7:16.459 Waiting 1.141 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
7:17.600 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
7:18.604 healing_touch Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
7:19.490 Waiting 1.400 sec 46.4/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
7:20.890 ferocious_bite Fluffy_Pillow 62.3/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
7:21.894 Waiting 1.215 sec 23.7/100: 24% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
7:23.109 rake Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:24.114 Waiting 2.380 sec 13.9/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:26.494 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:27.500 Waiting 2.521 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:30.021 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 34.77% 34.77% 6568
Haste 13.43% 13.43% 4364
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 21649 19943 0
Mastery 53.68% 51.54% 6219
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 849.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Ravaged Seed Pod
ilevel: 880, stats: { +1043 Haste }
Local Trinket2 Nature's Call
ilevel: 880, stats: { +348 Mastery, +348 Haste, +348 Crit }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="pod_880 / call_880"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/use_item,slot=trinket1,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=ravaged_seed_pod,id=139320,bonus_id=1806
trinket2=natures_call,id=139334,bonus_id=1806
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=848.75
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=6568
# gear_haste_rating=2909
# gear_mastery_rating=6219
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

Simulation & Raid Information

Iterations: 2502
Threads: 3
Confidence: 95.00%
Fight Length (fixed time): 360 - 540 ( 450.0 )

Performance:
Total Events Processed: 233774426
Max Event Queue: 529
Sim Seconds: 1125847
CPU Seconds: 378.7392
Physical Seconds: 215.7627
Speed Up: 2973

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
appendages_880 / call_880 appendages_880 / call_880 ashamanes_frenzy 210722 1249252 2776 12.17 10095 20190 6.1 91.3 35.5% 0.0% 0.0% 0.0% 78.61sec 7306887 449.98sec
appendages_880 / call_880 appendages_880 / call_880 ashamanes_frenzy ticks -210722 5470368 12156 16.20 133575 266987 6.1 121.5 35.7% 0.0% 0.0% 0.0% 78.61sec 7306887 449.98sec
appendages_880 / call_880 appendages_880 / call_880 ashamanes_rip ticks -210705 16550445 36779 19.27 84501 168948 18.4 144.5 35.6% 0.0% 0.0% 0.0% 23.17sec 16550445 449.98sec
appendages_880 / call_880 appendages_880 / call_880 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
appendages_880 / call_880 appendages_880 / call_880 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 181.99sec 0 449.98sec
appendages_880 / call_880 appendages_880 / call_880 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
appendages_880 / call_880 appendages_880 / call_880 cat_melee 0 12503583 27787 67.51 18234 36469 506.3 506.3 35.4% 0.0% 0.0% 0.0% 0.89sec 18381452 449.98sec
appendages_880 / call_880 appendages_880 / call_880 cleansed_drakes_breath 222520 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 78.07sec 0 449.98sec
appendages_880 / call_880 appendages_880 / call_880 ferocious_bite 22568 2857815 6351 1.40 189317 419204 10.5 10.5 35.7% 0.0% 0.0% 0.0% 44.67sec 4201258 449.98sec
appendages_880 / call_880 appendages_880 / call_880 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
appendages_880 / call_880 appendages_880 / call_880 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
appendages_880 / call_880 appendages_880 / call_880 healing_touch 5185 0 0 0.00 0 0 50.1 0.0 0.0% 0.0% 0.0% 0.0% 9.09sec 0 449.98sec
appendages_880 / call_880 appendages_880 / call_880 horrific_slam 222168 3666473 8148 13.29 27164 54334 99.7 99.7 35.4% 0.0% 0.0% 0.0% 3.57sec 3666473 449.98sec
appendages_880 / call_880 appendages_880 / call_880 lunar_inspiration 155625 1411450 3137 4.21 33010 66024 31.6 31.6 35.5% 0.0% 0.0% 0.0% 14.35sec 10004962 449.98sec
appendages_880 / call_880 appendages_880 / call_880 lunar_inspiration ticks -155625 8593512 19097 33.31 25395 50799 31.6 249.8 35.4% 0.0% 0.0% 0.0% 14.35sec 10004962 449.98sec
appendages_880 / call_880 appendages_880 / call_880 mark_of_the_distant_army ticks -191380 978873 2175 9.48 13773 0 24.0 71.1 0.0% 0.0% 0.0% 0.0% 18.50sec 1439036 449.98sec
appendages_880 / call_880 appendages_880 / call_880 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
appendages_880 / call_880 appendages_880 / call_880 potion_of_the_old_war 188028 5017818 11151 3.16 156560 313217 23.7 23.7 35.3% 0.0% 0.0% 0.0% 17.45sec 7376667 449.98sec
appendages_880 / call_880 appendages_880 / call_880 rake 1822 5529441 12288 6.29 86576 172454 47.2 47.2 35.7% 0.0% 0.0% 0.0% 9.57sec 31869564 449.98sec
appendages_880 / call_880 appendages_880 / call_880 rake ticks -1822 26340122 58534 29.79 87006 173938 47.2 223.4 35.5% 0.0% 0.0% 0.0% 9.57sec 31869564 449.98sec
appendages_880 / call_880 appendages_880 / call_880 rip ticks -1079 38362682 85250 43.49 86767 173532 22.8 326.2 35.6% 0.0% 0.0% 0.0% 15.57sec 38362682 449.98sec
appendages_880 / call_880 appendages_880 / call_880 savage_roar 52610 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 24.74sec 0 449.98sec
appendages_880 / call_880 appendages_880 / call_880 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.70sec 0 449.98sec
appendages_880 / call_880 appendages_880 / call_880 shred 5221 12948568 28776 14.36 88591 177438 107.7 107.7 35.6% 0.0% 0.0% 0.0% 4.17sec 19035621 449.98sec
appendages_880 / call_880 appendages_880 / call_880 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.33sec 0 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 ashamanes_frenzy 210722 1207941 2684 12.19 9880 19757 6.1 91.4 33.8% 0.0% 0.0% 0.0% 78.51sec 7060575 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 ashamanes_frenzy ticks -210722 5284788 11744 16.22 130628 261617 6.1 121.6 33.8% 0.0% 0.0% 0.0% 78.51sec 7060575 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 ashamanes_rip ticks -210705 16096911 35771 19.42 82653 165179 18.5 145.7 33.8% 0.0% 0.0% 0.0% 23.02sec 16096911 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 181.97sec 0 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 cat_melee 0 12573198 27942 68.73 18234 36471 515.4 515.4 33.8% 0.0% 0.0% 0.0% 0.87sec 18483792 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 ferocious_bite 22568 2845765 6324 1.42 190349 419912 10.6 10.6 33.8% 0.0% 0.0% 0.0% 44.37sec 4183544 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 healing_touch 5185 0 0 0.00 0 0 50.3 0.0 0.0% 0.0% 0.0% 0.0% 9.04sec 0 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 horrific_slam 222168 3666646 8148 13.45 27146 54324 100.9 100.9 33.9% 0.0% 0.0% 0.0% 3.55sec 3666646 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 infested_ground 221803 2728165 6063 10.35 26268 52521 7.9 77.7 33.8% 0.0% 0.0% 0.0% 60.67sec 2728165 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 lunar_inspiration 155625 1395454 3101 4.21 33007 66117 31.6 31.6 33.7% 0.0% 0.0% 0.0% 14.33sec 10054959 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 lunar_inspiration ticks -155625 8659505 19243 33.86 25478 50969 31.6 254.0 33.8% 0.0% 0.0% 0.0% 14.33sec 10054959 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 mark_of_the_distant_army ticks -191380 1006135 2236 9.74 13771 0 24.7 73.1 0.0% 0.0% 0.0% 0.0% 18.12sec 1479114 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 potion_of_the_old_war 188028 5061474 11248 3.22 156664 313055 24.2 24.2 33.7% 0.0% 0.0% 0.0% 17.00sec 7440846 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 rake 1822 5353628 11898 6.30 84694 169092 47.3 47.3 33.8% 0.0% 0.0% 0.0% 9.55sec 30858565 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 rake ticks -1822 25504938 56678 29.82 85209 170566 47.3 223.7 33.8% 0.0% 0.0% 0.0% 9.55sec 30858565 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 rip ticks -1079 37119153 82487 43.53 84988 169982 22.9 326.5 33.8% 0.0% 0.0% 0.0% 15.52sec 37119153 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 savage_roar 52610 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 24.69sec 0 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.80sec 0 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 shred 5221 13056322 29015 14.71 88449 176823 110.3 110.3 33.8% 0.0% 0.0% 0.0% 4.07sec 19194031 449.98sec
appendages_880 / pod_880 appendages_880 / pod_880 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.34sec 0 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 ashamanes_frenzy 210722 1288573 2864 12.18 10354 20708 6.1 91.4 36.2% 0.0% 0.0% 0.0% 78.52sec 7519800 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 ashamanes_frenzy ticks -210722 5625475 12501 16.21 136959 273928 6.1 121.6 36.0% 0.0% 0.0% 0.0% 78.52sec 7519800 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 ashamanes_rip ticks -210705 17156754 38126 19.41 86719 173366 18.4 145.6 35.9% 0.0% 0.0% 0.0% 22.95sec 17156754 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 181.93sec 0 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 cat_melee 0 12906796 28683 68.05 18594 37187 510.3 510.3 36.0% 0.0% 0.0% 0.0% 0.88sec 18974213 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 ferocious_bite 22568 3004674 6677 1.43 194657 431161 10.7 10.7 36.3% 0.0% 0.0% 0.0% 43.60sec 4417155 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 healing_touch 5185 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 9.00sec 0 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 horrific_slam 222168 3738033 8307 13.22 27698 55387 99.1 99.1 36.1% 0.0% 0.0% 0.0% 3.62sec 3738033 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 lunar_inspiration 155625 1446726 3215 4.21 33647 67336 31.6 31.6 36.1% 0.0% 0.0% 0.0% 14.35sec 10320160 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 lunar_inspiration ticks -155625 8873434 19719 33.59 25890 51773 31.6 251.9 36.1% 0.0% 0.0% 0.0% 14.35sec 10320160 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 mark_of_the_distant_army ticks -191380 1004739 2233 9.54 14044 0 24.2 71.5 0.0% 0.0% 0.0% 0.0% 18.49sec 1477061 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 potion_of_the_old_war 188028 5141766 11427 3.17 159670 319369 23.7 23.7 35.6% 0.0% 0.0% 0.0% 17.42sec 7558884 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 rake 1822 5713800 12698 6.30 88971 177630 47.3 47.3 36.0% 0.0% 0.0% 0.0% 9.54sec 32953978 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 rake ticks -1822 27240178 60534 29.80 89499 179192 47.3 223.5 36.1% 0.0% 0.0% 0.0% 9.54sec 32953978 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 rip ticks -1079 39611745 88026 43.56 89097 178167 22.9 326.7 36.1% 0.0% 0.0% 0.0% 15.53sec 39611745 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 savage_roar 52610 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 24.60sec 0 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.30sec 0 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 shred 5221 13345932 29659 14.46 90425 180753 108.5 108.5 36.1% 0.0% 0.0% 0.0% 4.14sec 19619784 449.98sec
arcanocrystal_860 / appendages_880 arcanocrystal_860 / appendages_880 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.33sec 0 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 ashamanes_frenzy 210722 1287359 2861 12.21 10203 20412 6.1 91.6 37.8% 0.0% 0.0% 0.0% 78.42sec 7526853 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 ashamanes_frenzy ticks -210722 5634314 12521 16.24 135051 269751 6.1 121.8 38.0% 0.0% 0.0% 0.0% 78.42sec 7526853 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 ashamanes_rip ticks -210705 17528876 38953 19.84 85502 171040 18.6 148.8 37.8% 0.0% 0.0% 0.0% 22.83sec 17528876 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.00sec 0 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 cat_melee 0 13429196 29844 69.77 18612 37235 523.3 523.3 37.9% 0.0% 0.0% 0.0% 0.86sec 19742190 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 cleansed_drakes_breath 222520 0 0 0.00 0 0 4.2 0.0 0.0% 0.0% 0.0% 0.0% 78.87sec 0 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 ferocious_bite 22568 3327392 7395 1.52 200302 445149 11.4 11.4 37.7% 0.0% 0.0% 0.0% 41.08sec 4891581 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 healing_touch 5185 0 0 0.00 0 0 51.8 0.0 0.0% 0.0% 0.0% 0.0% 8.78sec 0 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 lunar_inspiration 155625 1468070 3263 4.22 33695 67304 31.6 31.6 37.9% 0.0% 0.0% 0.0% 14.34sec 10708872 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 lunar_inspiration ticks -155625 9240802 20535 34.38 26007 51986 31.6 257.8 37.8% 0.0% 0.0% 0.0% 14.34sec 10708872 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 mark_of_the_distant_army ticks -191380 1031332 2292 9.78 14062 0 24.8 73.3 0.0% 0.0% 0.0% 0.0% 18.09sec 1516155 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 potion_of_the_old_war 188028 5365099 11923 3.25 159798 319768 24.4 24.4 37.7% 0.0% 0.0% 0.0% 16.88sec 7887204 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 rake 1822 5745839 12769 6.34 87619 175665 47.5 47.5 37.8% 0.0% 0.0% 0.0% 9.49sec 33019403 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 rake ticks -1822 27273564 60608 29.79 88558 177048 47.5 223.4 37.9% 0.0% 0.0% 0.0% 9.49sec 33019403 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 rip ticks -1079 39697965 88218 43.67 87935 175913 23.1 327.5 37.8% 0.0% 0.0% 0.0% 15.26sec 39697965 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 savage_roar 52610 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 24.42sec 0 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 132.92sec 0 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 shred 5221 13802098 30673 14.75 90616 181094 110.6 110.6 37.7% 0.0% 0.0% 0.0% 4.06sec 20290392 449.98sec
arcanocrystal_860 / call_880 arcanocrystal_860 / call_880 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.34sec 0 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 ashamanes_frenzy 210722 1244107 2765 12.22 9979 19954 6.1 91.7 36.0% 0.0% 0.0% 0.0% 78.36sec 7265602 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 ashamanes_frenzy ticks -210722 5436646 12081 16.26 132038 263838 6.1 122.0 36.0% 0.0% 0.0% 0.0% 78.36sec 7265602 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 ashamanes_rip ticks -210705 17228139 38285 20.12 83861 167804 19.0 150.9 36.1% 0.0% 0.0% 0.0% 22.15sec 17228139 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.03sec 0 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 cat_melee 0 13493526 29987 71.03 18616 37223 532.7 532.7 36.1% 0.0% 0.0% 0.0% 0.84sec 19836762 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 ferocious_bite 22568 3309967 7356 1.53 200752 443940 11.5 11.5 36.0% 0.0% 0.0% 0.0% 40.63sec 4865965 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 healing_touch 5185 0 0 0.00 0 0 51.9 0.0 0.0% 0.0% 0.0% 0.0% 8.76sec 0 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 infested_ground 221803 2835047 6300 10.36 26815 53634 7.9 77.7 36.1% 0.0% 0.0% 0.0% 60.68sec 2835047 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 lunar_inspiration 155625 1453548 3230 4.22 33680 67363 31.7 31.7 36.3% 0.0% 0.0% 0.0% 14.31sec 10756517 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 lunar_inspiration ticks -155625 9302969 20673 35.26 25845 51680 31.7 264.5 36.1% 0.0% 0.0% 0.0% 14.31sec 10756517 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 mark_of_the_distant_army ticks -191380 1050310 2334 9.96 14061 0 25.3 74.7 0.0% 0.0% 0.0% 0.0% 17.66sec 1544055 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 potion_of_the_old_war 188028 5389198 11977 3.31 159412 318733 24.8 24.8 36.1% 0.0% 0.0% 0.0% 16.54sec 7922631 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 rake 1822 5562274 12361 6.33 85917 171973 47.5 47.5 36.2% 0.0% 0.0% 0.0% 9.49sec 31945644 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 rake ticks -1822 26383370 58630 29.82 86813 173219 47.5 223.7 36.0% 0.0% 0.0% 0.0% 9.49sec 31945644 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 rip ticks -1079 38429072 85398 43.70 86155 172326 23.1 327.7 36.1% 0.0% 0.0% 0.0% 15.26sec 38429072 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 savage_roar 52610 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 24.41sec 0 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.75sec 0 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 shred 5221 13923302 30942 15.07 90466 180911 113.0 113.0 36.2% 0.0% 0.0% 0.0% 3.97sec 20468573 449.98sec
arcanocrystal_860 / pod_880 arcanocrystal_860 / pod_880 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.34sec 0 449.98sec
baseline baseline ashamanes_frenzy 210722 1162197 2583 12.16 9529 19051 6.1 91.2 33.8% 0.0% 0.0% 0.0% 78.79sec 6790811 449.98sec
baseline baseline ashamanes_frenzy ticks -210722 5082271 11294 16.17 126081 251903 6.1 121.3 33.9% 0.0% 0.0% 0.0% 78.79sec 6790811 449.98sec
baseline baseline ashamanes_rip ticks -210705 14939070 33198 18.76 79378 158831 18.0 140.7 33.7% 0.0% 0.0% 0.0% 23.35sec 14939070 449.98sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
baseline baseline berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.07sec 0 449.98sec
baseline baseline cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
baseline baseline cat_melee 0 12009029 26688 65.77 18194 36395 493.3 493.3 33.8% 0.0% 0.0% 0.0% 0.91sec 17654410 449.98sec
baseline baseline ferocious_bite 22568 2541311 5648 1.31 182889 402372 9.9 9.9 34.1% 0.0% 0.0% 0.0% 47.92sec 3735967 449.98sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
baseline baseline healing_touch 5185 0 0 0.00 0 0 48.9 0.0 0.0% 0.0% 0.0% 0.0% 9.31sec 0 449.98sec
baseline baseline lunar_inspiration 155625 1388375 3085 4.20 32940 66006 31.5 31.5 33.6% 0.0% 0.0% 0.0% 14.38sec 9619907 449.98sec
baseline baseline lunar_inspiration ticks -155625 8231532 18292 32.25 25446 50885 31.5 241.9 33.7% 0.0% 0.0% 0.0% 14.38sec 9619907 449.98sec
baseline baseline mark_of_the_distant_army ticks -191380 958886 2131 9.29 13764 0 23.6 69.7 0.0% 0.0% 0.0% 0.0% 18.96sec 1409653 449.98sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
baseline baseline potion_of_the_old_war 188028 4811339 10692 3.06 156433 312910 22.9 22.9 34.2% 0.0% 0.0% 0.0% 18.12sec 7073125 449.98sec
baseline baseline rake 1822 5094467 11322 6.25 81243 162781 46.9 46.9 33.7% 0.0% 0.0% 0.0% 9.63sec 29460513 449.98sec
baseline baseline rake ticks -1822 24366046 54147 29.79 81497 163249 46.9 223.4 33.7% 0.0% 0.0% 0.0% 9.63sec 29460513 449.98sec
baseline baseline rip ticks -1079 35446224 78769 43.32 81564 163060 22.6 324.9 33.8% 0.0% 0.0% 0.0% 15.79sec 35446224 449.98sec
baseline baseline savage_roar 52610 0 0 0.00 0 0 18.4 0.0 0.0% 0.0% 0.0% 0.0% 25.01sec 0 449.98sec
baseline baseline shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.72sec 0 449.98sec
baseline baseline shred 5221 12491887 27761 14.09 88345 176857 105.7 105.7 33.8% 0.0% 0.0% 0.0% 4.24sec 18364257 449.98sec
baseline baseline tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.34sec 0 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 ashamanes_frenzy 210722 1302435 2894 12.17 10665 21319 6.1 91.3 33.8% 0.0% 0.0% 0.0% 78.46sec 7600927 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 ashamanes_frenzy ticks -210722 5686224 12636 16.20 141075 282038 6.1 121.5 33.6% 0.0% 0.0% 0.0% 78.46sec 7600927 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 ashamanes_rip ticks -210705 17519325 38932 19.54 89298 178577 18.6 146.6 33.9% 0.0% 0.0% 0.0% 22.83sec 17519325 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.03sec 0 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 cat_melee 0 13360776 29692 69.24 19232 38466 519.2 519.2 33.8% 0.0% 0.0% 0.0% 0.87sec 19641607 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 ferocious_bite 22568 3108609 6908 1.42 205823 457668 10.7 10.7 33.8% 0.0% 0.0% 0.0% 44.00sec 4569950 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 healing_touch 5185 0 0 0.00 0 0 50.4 0.0 0.0% 0.0% 0.0% 0.0% 9.02sec 0 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 horrific_slam 222168 3664002 8143 13.45 27163 54294 100.9 100.9 33.8% 0.0% 0.0% 0.0% 3.53sec 3664002 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 lunar_inspiration 155625 1506626 3348 4.22 35635 71232 31.6 31.6 33.7% 0.0% 0.0% 0.0% 14.33sec 10916473 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 lunar_inspiration ticks -155625 9409846 20911 34.19 27429 54862 31.6 256.4 33.8% 0.0% 0.0% 0.0% 14.33sec 10916473 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 mark_of_the_distant_army ticks -191380 1013381 2252 9.81 13777 0 24.9 73.6 0.0% 0.0% 0.0% 0.0% 17.96sec 1489766 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 potion_of_the_old_war 188028 5100521 11335 3.24 156704 313359 24.3 24.3 34.0% 0.0% 0.0% 0.0% 16.86sec 7498249 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 rake 1822 5779648 12844 6.30 91364 183270 47.3 47.3 33.6% 0.0% 0.0% 0.0% 9.54sec 33323003 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 rake ticks -1822 27543354 61207 29.81 92063 184059 47.3 223.6 33.8% 0.0% 0.0% 0.0% 9.54sec 33323003 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 rip ticks -1079 40049000 88998 43.54 91730 183504 22.9 326.5 33.7% 0.0% 0.0% 0.0% 15.50sec 40049000 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 savage_roar 52610 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 24.66sec 0 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 132.88sec 0 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 shred 5221 13822035 30717 14.79 93296 186429 110.9 110.9 33.6% 0.0% 0.0% 0.0% 4.04sec 20319700 449.98sec
instinct_880 / appendages_880 instinct_880 / appendages_880 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.34sec 0 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 ashamanes_frenzy 210722 1346513 2992 12.23 10791 21571 6.1 91.7 36.1% 0.0% 0.0% 0.0% 78.30sec 7866708 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 ashamanes_frenzy ticks -210722 5887206 13083 16.27 142716 285480 6.1 122.0 36.1% 0.0% 0.0% 0.0% 78.30sec 7866708 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 ashamanes_rip ticks -210705 18646029 41436 20.20 90489 180907 19.2 151.5 36.1% 0.0% 0.0% 0.0% 22.33sec 18646029 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.08sec 0 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 cat_melee 0 14332306 31851 71.53 19636 39273 536.4 536.4 36.1% 0.0% 0.0% 0.0% 0.84sec 21069847 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 ferocious_bite 22568 3676507 8170 1.55 218248 483584 11.7 11.7 36.6% 0.0% 0.0% 0.0% 40.04sec 5404813 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 healing_touch 5185 0 0 0.00 0 0 52.2 0.0 0.0% 0.0% 0.0% 0.0% 8.73sec 0 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 lunar_inspiration 155625 1569329 3488 4.23 36383 72721 31.7 31.7 36.2% 0.0% 0.0% 0.0% 14.30sec 11679732 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 lunar_inspiration ticks -155625 10110403 22468 35.35 28025 56064 31.7 265.2 36.0% 0.0% 0.0% 0.0% 14.30sec 11679732 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 mark_of_the_distant_army ticks -191380 1060990 2358 10.07 14054 0 25.5 75.5 0.0% 0.0% 0.0% 0.0% 17.47sec 1559756 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 potion_of_the_old_war 188028 5377968 11952 3.30 159731 319312 24.8 24.8 36.0% 0.0% 0.0% 0.0% 16.53sec 7906123 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 rake 1822 6000278 13335 6.36 92739 185180 47.7 47.7 35.8% 0.0% 0.0% 0.0% 9.47sec 34508024 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 rake ticks -1822 28507745 63351 29.83 93567 187498 47.7 223.7 36.1% 0.0% 0.0% 0.0% 9.47sec 34508024 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 rip ticks -1079 41486070 92191 43.70 93018 185958 23.1 327.7 36.1% 0.0% 0.0% 0.0% 15.26sec 41486070 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 savage_roar 52610 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 24.33sec 0 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.17sec 0 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 shred 5221 14794143 32877 15.19 95345 190794 113.9 113.9 36.2% 0.0% 0.0% 0.0% 3.94sec 21748791 449.98sec
instinct_880 / arcanocrystal_860 instinct_880 / arcanocrystal_860 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.35sec 0 449.98sec
instinct_880 / call_880 instinct_880 / call_880 ashamanes_frenzy 210722 1306228 2903 12.20 10518 21051 6.1 91.5 35.7% 0.0% 0.0% 0.0% 78.45sec 7639735 449.98sec
instinct_880 / call_880 instinct_880 / call_880 ashamanes_frenzy ticks -210722 5719456 12710 16.23 139157 278329 6.1 121.7 35.9% 0.0% 0.0% 0.0% 78.45sec 7639735 449.98sec
instinct_880 / call_880 instinct_880 / call_880 ashamanes_rip ticks -210705 18027234 40061 20.11 88160 176324 19.1 150.8 35.6% 0.0% 0.0% 0.0% 22.29sec 18027234 449.98sec
instinct_880 / call_880 instinct_880 / call_880 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / call_880 instinct_880 / call_880 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.06sec 0 449.98sec
instinct_880 / call_880 instinct_880 / call_880 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / call_880 instinct_880 / call_880 cat_melee 0 13891962 30872 71.00 19261 38520 532.5 532.5 35.5% 0.0% 0.0% 0.0% 0.84sec 20422501 449.98sec
instinct_880 / call_880 instinct_880 / call_880 cleansed_drakes_breath 222520 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 78.96sec 0 449.98sec
instinct_880 / call_880 instinct_880 / call_880 ferocious_bite 22568 3457350 7683 1.52 212516 468596 11.4 11.4 35.7% 0.0% 0.0% 0.0% 40.87sec 5082632 449.98sec
instinct_880 / call_880 instinct_880 / call_880 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / call_880 instinct_880 / call_880 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / call_880 instinct_880 / call_880 healing_touch 5185 0 0 0.00 0 0 51.8 0.0 0.0% 0.0% 0.0% 0.0% 8.78sec 0 449.98sec
instinct_880 / call_880 instinct_880 / call_880 lunar_inspiration 155625 1532617 3406 4.22 35698 71367 31.7 31.7 35.6% 0.0% 0.0% 0.0% 14.30sec 11331749 449.98sec
instinct_880 / call_880 instinct_880 / call_880 lunar_inspiration ticks -155625 9799132 21776 35.10 27491 54983 31.7 263.2 35.4% 0.0% 0.0% 0.0% 14.30sec 11331749 449.98sec
instinct_880 / call_880 instinct_880 / call_880 mark_of_the_distant_army ticks -191380 1031088 2291 9.97 13785 0 25.3 74.8 0.0% 0.0% 0.0% 0.0% 17.69sec 1515798 449.98sec
instinct_880 / call_880 instinct_880 / call_880 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / call_880 instinct_880 / call_880 potion_of_the_old_war 188028 5267341 11706 3.31 156634 313277 24.8 24.8 35.7% 0.0% 0.0% 0.0% 16.58sec 7743491 449.98sec
instinct_880 / call_880 instinct_880 / call_880 rake 1822 5806423 12904 6.33 90227 180435 47.5 47.5 35.5% 0.0% 0.0% 0.0% 9.49sec 33403739 449.98sec
instinct_880 / call_880 instinct_880 / call_880 rake ticks -1822 27597316 61327 29.83 91073 182200 47.5 223.7 35.4% 0.0% 0.0% 0.0% 9.49sec 33403739 449.98sec
instinct_880 / call_880 instinct_880 / call_880 rip ticks -1079 40197116 89327 43.67 90545 181131 23.1 327.5 35.5% 0.0% 0.0% 0.0% 15.24sec 40197116 449.98sec
instinct_880 / call_880 instinct_880 / call_880 savage_roar 52610 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 24.41sec 0 449.98sec
instinct_880 / call_880 instinct_880 / call_880 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.30sec 0 449.98sec
instinct_880 / call_880 instinct_880 / call_880 shred 5221 14359115 31911 15.11 93481 187074 113.3 113.3 35.5% 0.0% 0.0% 0.0% 3.96sec 21109260 449.98sec
instinct_880 / call_880 instinct_880 / call_880 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.35sec 0 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 ashamanes_frenzy 210722 1259959 2800 12.23 10283 20555 6.1 91.7 33.7% 0.0% 0.0% 0.0% 78.28sec 7363678 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 ashamanes_frenzy ticks -210722 5511420 12248 16.26 135937 272251 6.1 122.0 33.7% 0.0% 0.0% 0.0% 78.28sec 7363678 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 ashamanes_rip ticks -210705 17626013 39169 20.38 86195 172469 19.3 152.8 33.8% 0.0% 0.0% 0.0% 22.09sec 17626013 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.07sec 0 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 cat_melee 0 13952679 31007 72.20 19264 38537 541.5 541.5 33.8% 0.0% 0.0% 0.0% 0.83sec 20511760 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 ferocious_bite 22568 3425660 7613 1.53 213182 468088 11.5 11.5 33.4% 0.0% 0.0% 0.0% 40.81sec 5036044 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 healing_touch 5185 0 0 0.00 0 0 51.9 0.0 0.0% 0.0% 0.0% 0.0% 8.76sec 0 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 infested_ground 221803 2731882 6071 10.34 26322 52650 7.8 77.6 33.8% 0.0% 0.0% 0.0% 60.69sec 2731882 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 lunar_inspiration 155625 1516776 3371 4.23 35718 71333 31.7 31.7 33.9% 0.0% 0.0% 0.0% 14.28sec 11369850 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 lunar_inspiration ticks -155625 9853075 21896 35.70 27511 55024 31.7 267.8 33.8% 0.0% 0.0% 0.0% 14.28sec 11369850 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 mark_of_the_distant_army ticks -191380 1054497 2343 10.20 13785 0 25.9 76.5 0.0% 0.0% 0.0% 0.0% 17.17sec 1550210 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 potion_of_the_old_war 188028 5263703 11698 3.34 156630 313651 25.1 25.1 34.0% 0.0% 0.0% 0.0% 16.47sec 7738142 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 rake 1822 5605351 12457 6.34 88272 176332 47.5 47.5 33.6% 0.0% 0.0% 0.0% 9.48sec 32283365 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 rake ticks -1822 26678014 59284 29.85 89133 178041 47.5 223.9 33.8% 0.0% 0.0% 0.0% 9.48sec 32283365 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 rip ticks -1079 38845202 86323 43.69 88627 177257 23.1 327.7 33.8% 0.0% 0.0% 0.0% 15.21sec 38845202 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 savage_roar 52610 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 24.37sec 0 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.16sec 0 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 shred 5221 14479956 32179 15.44 93411 186734 115.8 115.8 33.9% 0.0% 0.0% 0.0% 3.88sec 21286907 449.98sec
instinct_880 / pod_880 instinct_880 / pod_880 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.35sec 0 449.98sec
pod_880 / call_880 pod_880 / call_880 ashamanes_frenzy 210722 1208328 2685 12.20 9736 19466 6.1 91.5 35.7% 0.0% 0.0% 0.0% 78.51sec 7058511 449.98sec
pod_880 / call_880 pod_880 / call_880 ashamanes_frenzy ticks -210722 5282155 11738 16.23 128778 257573 6.1 121.7 35.6% 0.0% 0.0% 0.0% 78.51sec 7058511 449.98sec
pod_880 / call_880 pod_880 / call_880 ashamanes_rip ticks -210705 16529420 36732 19.97 81596 163008 19.0 149.8 35.3% 0.0% 0.0% 0.0% 22.46sec 16529420 449.98sec
pod_880 / call_880 pod_880 / call_880 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
pod_880 / call_880 pod_880 / call_880 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.04sec 0 449.98sec
pod_880 / call_880 pod_880 / call_880 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
pod_880 / call_880 pod_880 / call_880 cat_melee 0 13072704 29052 70.46 18260 36514 528.4 528.4 35.5% 0.0% 0.0% 0.0% 0.85sec 19218114 449.98sec
pod_880 / call_880 pod_880 / call_880 cleansed_drakes_breath 222520 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 79.89sec 0 449.98sec
pod_880 / call_880 pod_880 / call_880 ferocious_bite 22568 3149881 7000 1.50 194828 434157 11.3 11.3 35.3% 0.0% 0.0% 0.0% 41.60sec 4630623 449.98sec
pod_880 / call_880 pod_880 / call_880 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
pod_880 / call_880 pod_880 / call_880 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
pod_880 / call_880 pod_880 / call_880 healing_touch 5185 0 0 0.00 0 0 51.5 0.0 0.0% 0.0% 0.0% 0.0% 8.84sec 0 449.98sec
pod_880 / call_880 pod_880 / call_880 infested_ground 221803 2764693 6144 10.35 26297 52608 7.9 77.6 35.4% 0.0% 0.0% 0.0% 60.68sec 2764693 449.98sec
pod_880 / call_880 pod_880 / call_880 lunar_inspiration 155625 1417031 3149 4.22 33033 66100 31.7 31.7 35.4% 0.0% 0.0% 0.0% 14.31sec 10417268 449.98sec
pod_880 / call_880 pod_880 / call_880 lunar_inspiration ticks -155625 9000237 20001 34.65 25567 51131 31.7 259.9 35.5% 0.0% 0.0% 0.0% 14.31sec 10417268 449.98sec
pod_880 / call_880 pod_880 / call_880 mark_of_the_distant_army ticks -191380 1024542 2277 9.91 13791 0 25.2 74.3 0.0% 0.0% 0.0% 0.0% 17.76sec 1506174 449.98sec
pod_880 / call_880 pod_880 / call_880 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
pod_880 / call_880 pod_880 / call_880 potion_of_the_old_war 188028 5191847 11538 3.26 156853 313504 24.5 24.5 35.2% 0.0% 0.0% 0.0% 16.70sec 7632507 449.98sec
pod_880 / call_880 pod_880 / call_880 rake 1822 5374261 11943 6.34 83544 167012 47.5 47.5 35.4% 0.0% 0.0% 0.0% 9.49sec 30944695 449.98sec
pod_880 / call_880 pod_880 / call_880 rake ticks -1822 25570434 56823 29.83 84327 168636 47.5 223.7 35.5% 0.0% 0.0% 0.0% 9.49sec 30944695 449.98sec
pod_880 / call_880 pod_880 / call_880 rip ticks -1079 37182551 82628 43.63 83818 167592 23.1 327.2 35.6% 0.0% 0.0% 0.0% 15.32sec 37182551 449.98sec
pod_880 / call_880 pod_880 / call_880 savage_roar 52610 0 0 0.00 0 0 18.7 0.0 0.0% 0.0% 0.0% 0.0% 24.52sec 0 449.98sec
pod_880 / call_880 pod_880 / call_880 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.03sec 0 449.98sec
pod_880 / call_880 pod_880 / call_880 shred 5221 13507409 30018 14.98 88615 177499 112.4 112.4 35.5% 0.0% 0.0% 0.0% 3.99sec 19857171 449.98sec
pod_880 / call_880 pod_880 / call_880 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.34sec 0 449.98sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.34% 9.34% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.35% 9.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.35%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.79% 9.79% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.72% 10.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.69% 10.69% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.69%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.31% 10.31% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.74% 10.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.74%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.97% 10.97% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.97%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.46% 10.46% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 7.62% 7.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:7.62%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 3508625.83
Combat End Resource Mean Min Max
Health 13406319.61 0.00 80843823.49

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 2499
Mean 3525249.82
Minimum 3377104.31
Maximum 3668316.26
Spread ( max - min ) 291211.95
Range [ ( max - min ) / 2 * 100% ] 4.13%
Standard Deviation 41704.5717
5th Percentile 3455568.98
95th Percentile 3592532.68
( 95th Percentile - 5th Percentile ) 136963.70
Mean Distribution
Standard Deviation 834.2583
95.00% Confidence Intervall ( 3523614.70 - 3526884.94 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 5
0.1% Error 537
0.1 Scale Factor Error with Delta=300 14847420
0.05 Scale Factor Error with Delta=300 59389680
0.01 Scale Factor Error with Delta=300 1484742015
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 983
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1913422554 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.