close

SimulationCraft 703-03

for World of Warcraft 7.0.3 Live (wow build level 22522)

Current simulator hotfixes

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

appendages_865 / call_865 : 312017 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
312016.7 312016.7 410.3 / 0.131% 40602.3 / 13.0% 21215.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.7 14.7 Energy 30.85% 42.8 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
appendages_865 / call_865 312017
Ashamane's Frenzy 14908 4.8% 6.1 78.57sec 1097227 1092410 Direct 91.4 10069 20152 13648 35.5%  
Periodic 30.2 133228 266409 180624 35.6% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.11 91.42 121.64 30.22 1.0045 0.6472 6706302.56 7292810.01 8.04 79021.32 1092409.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.97 64.51% 10068.56 7431 12876 10070.50 8752 11146 593744 872860 31.98
crit 32.45 35.49% 20152.41 14862 25752 20156.80 17896 22615 653893 961285 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.5 64.41% 133227.60 81930 177456 133233.65 115515 149865 2593464 2593464 0.00
crit 10.8 35.59% 266409.06 167956 354912 266472.57 234260 316002 2865202 2865202 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 36315 11.6% 18.2 23.15sec 897697 0 Periodic 143.3 84120 168318 113980 35.5% 41.0%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.20 0.00 143.35 143.35 0.0000 1.2884 16338882.43 16338882.43 0.00 88464.61 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.5 64.54% 84120.29 58 107490 84038.53 74845 91787 7782481 7782481 0.00
crit 50.8 35.46% 168317.63 116 214980 168188.28 144320 191148 8556401 8556401 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 27748 8.9% 505.7 0.89sec 24687 27809 Direct 505.7 18232 36459 24687 35.4%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 505.69 505.69 0.00 0.00 0.8877 0.0000 12483860.76 18352457.83 31.98 27809.09 27809.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 326.61 64.59% 18232.39 14216 20436 18232.37 17859 18499 5954971 8754371 31.98
crit 179.07 35.41% 36459.15 28433 40872 36459.27 35159 37219 6528890 9598087 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6278 2.0% 10.5 45.04sec 268854 267655 Direct 10.5 188189 419372 268835 34.9%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.49 10.49 0.00 0.00 1.0045 0.0000 2821083.29 4147259.66 31.98 267654.96 267654.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.83 65.11% 188189.47 14689 251221 187774.61 0 251221 1285784 1890224 31.96
crit 3.66 34.89% 419372.29 32473 555198 412518.74 0 555198 1535299 2257036 31.58
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Horrific Slam 7019 2.3% 98.8 3.57sec 31971 0 Direct 98.8 23608 47214 31973 35.4%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.78 98.78 0.00 0.00 0.0000 0.0000 3158254.92 3158254.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.78 64.57% 23607.72 18381 26423 23605.62 21445 25092 1505723 1505723 0.00
crit 35.00 35.43% 47214.24 36763 52846 47200.61 42014 50804 1652532 1652532 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16532.30
  • base_dd_max:18272.54
 
Moonfire (lunar_inspiration) 22206 7.1% 31.6 14.35sec 316411 314996 Direct 31.6 33027 66018 44693 35.4%  
Periodic 249.7 25389 50740 34360 35.4% 96.8%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.57 31.57 249.68 249.68 1.0045 1.7443 9990423.73 9990423.73 0.00 21382.15 314996.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.41 64.63% 33027.13 25727 36982 33028.42 30852 34712 674017 674017 0.00
crit 11.17 35.37% 66018.47 51454 73964 66012.43 59493 72357 737191 737191 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 161.3 64.61% 25388.60 43 28764 25388.69 24518 26051 4095851 4095851 0.00
crit 88.4 35.39% 50740.11 87 57529 50742.17 48160 52526 4483365 4483365 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2189 0.7% 24.2 18.46sec 40722 0 Periodic 71.5 13775 0 13775 0.0% 7.9%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.18 0.00 71.49 71.49 0.0000 0.4971 984750.81 1447676.97 31.98 27711.36 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.5 100.00% 13775.47 27 15493 13777.63 12586 14497 984751 1447677 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11230 3.6% 23.6 17.36sec 211821 0 Direct 23.6 156401 313553 211831 35.3%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.55 23.55 0.00 0.00 0.0000 0.0000 4988693.03 7333851.30 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.25 64.73% 156400.67 122075 175482 156362.77 141244 169240 2384329 3505189 31.98
crit 8.31 35.27% 313553.25 244149 350964 313328.58 244149 350964 2604364 3828662 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 70522 22.6% 47.1 9.57sec 673318 670311 Direct 47.1 86222 172597 116814 35.4%  
Periodic 223.4 86706 173470 117377 35.3% 94.7%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.13 47.13 223.44 223.44 1.0045 1.9071 31731874.10 31731874.10 0.00 67022.23 670311.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.43 64.58% 86222.45 40175 208844 86243.36 73002 98642 2624090 2624090 0.00
crit 16.69 35.42% 172596.95 80351 417687 172619.27 135058 222381 2881257 2881257 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 144.5 64.65% 86706.02 37 208844 86726.78 76288 95740 12525152 12525152 0.00
crit 79.0 35.35% 173469.83 160 417687 173489.69 148862 200024 13701375 13701375 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 84853 27.2% 22.8 15.61sec 1674373 1666930 Periodic 326.2 86486 172958 117092 35.4% 96.0%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.82 0.00 326.25 326.25 1.0045 1.3241 38201024.92 38201024.92 0.00 83974.35 1666929.57
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 210.8 64.61% 86486.24 67 107490 86474.08 79708 90491 18230147 18230147 0.00
crit 115.5 35.39% 172957.85 133 214980 172939.59 158735 181161 19970878 19970878 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 28748 9.2% 107.7 4.17sec 120043 119506 Direct 107.7 88606 177233 120035 35.5%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.65 107.65 0.00 0.00 1.0045 0.0000 12922638.34 18997502.43 31.98 119505.78 119505.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.47 64.53% 88606.12 61977 133637 88621.37 83734 96388 6155331 9048920 31.98
crit 38.18 35.47% 177233.01 123954 267275 177164.43 162468 194382 6767307 9948582 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
appendages_865 / call_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:appendages_865 / call_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 181.97sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Cleansed Drake's Breath 4.3 78.73sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:appendages_865 / call_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:appendages_865 / call_865
  • harmful:false
  • if_expr:
 
Healing Touch 50.1 9.10sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.07 0.00 0.00 0.00 0.8798 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.5 24.73sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.55 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.20sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.33sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.18% 45.4(45.4) 15.1

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 15.05% 0.0(0.0) 2.9

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.20% 0.0(0.0) 1.0

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 50.0 0.0 9.1sec 9.1sec 46.21% 46.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:19.04%
  • bloodtalons_2:27.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Cleansed Ancient's Blessing 4.0 0.3 86.7sec 78.2sec 9.08% 9.18% 0.3(0.3) 3.9

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_ancients_blessing_1:9.08%

Trigger Attempt Success

  • trigger_pct:98.72%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 4.0 0.3 88.2sec 80.2sec 9.05% 9.15% 0.3(0.3) 3.9

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_sisters_blessing_1:9.05%

Trigger Attempt Success

  • trigger_pct:98.92%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 3.9 0.3 87.4sec 79.0sec 9.02% 9.08% 0.3(0.3) 3.8

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_wisps_blessing_1:9.02%

Trigger Attempt Success

  • trigger_pct:98.92%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Clearcasting 42.9 1.3 10.3sec 10.0sec 6.27% 15.15% 1.3(1.3) 0.0

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.27%

Trigger Attempt Success

  • trigger_pct:8.74%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Horrific Appendages 5.6 1.0 73.3sec 60.4sec 16.68% 16.77% 99.8(99.8) 5.4

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:16.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Jacin's Ruse 6.7 1.8 63.0sec 48.0sec 24.91% 24.99% 1.8(1.8) 6.5

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.7sec 0.0sec 10.81% 10.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 49.8 1.3 9.0sec 8.8sec 74.29% 74.30% 1.3(1.3) 0.0

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.29%

Trigger Attempt Success

  • trigger_pct:98.37%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.3 10.2 47.4sec 24.7sec 93.27% 93.00% 202.7(202.7) 7.3

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.5sec 133.5sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.81% 29.24% 0.0(0.0) 14.9

Buff details

  • buff initial source:appendages_865 / call_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
appendages_865 / call_865
ferocious_bite Energy 21.0 352.9 16.8 33.6 7993.9
ferocious_bite Combo Points 10.5 48.3 4.6 4.6 58463.4
lunar_inspiration Energy 31.6 780.6 24.7 24.7 12797.9
rake Energy 47.1 1341.3 28.5 28.5 23658.0
rip Energy 22.8 464.8 20.4 20.4 82193.0
rip Combo Points 22.8 114.1 5.0 5.0 334877.2
savage_roar Energy 18.5 481.4 26.0 26.0 0.0
savage_roar Combo Points 18.5 92.7 5.0 5.0 0.0
shred Energy 107.7 3193.5 29.7 29.7 4046.6
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.13 47.13 (18.25%) 1.00 0.00 0.00%
tigers_fury Energy 15.21 912.23 (11.35%) 59.98 0.36 0.04%
ashamanes_frenzy Combo Points 6.11 18.34 (7.10%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.57 31.57 (12.22%) 1.00 0.00 0.00%
shred Combo Points 107.65 107.65 (41.68%) 1.00 0.00 0.00%
energy_regen Energy 2074.55 4999.73 (62.20%) 2.41 64.78 1.28%
clearcasting Energy 42.84 1463.10 (18.20%) 34.15 0.00 0.00%
ashamanes_energy Energy 45.45 662.86 (8.25%) 14.59 18.85 2.76%
primal_fury Combo Points 66.03 53.59 (20.75%) 0.81 12.44 18.83%
Resource RPS-Gain RPS-Loss
Energy 14.61 14.70
Combo Points 0.57 0.57
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 36.28 0.00 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.20 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
clearcasting 44.2 10.0sec
clearcasting_wasted 1.3 121.2sec
primal_fury 66.0 6.8sec

Statistics & Data Analysis

Fight Length
Sample Data appendages_865 / call_865 Fight Length
Count 2499
Mean 450.05
Minimum 360.07
Maximum 539.96
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data appendages_865 / call_865 Damage Per Second
Count 2499
Mean 312016.68
Minimum 268272.45
Maximum 344754.21
Spread ( max - min ) 76481.75
Range [ ( max - min ) / 2 * 100% ] 12.26%
Standard Deviation 10464.0166
5th Percentile 295508.58
95th Percentile 329231.73
( 95th Percentile - 5th Percentile ) 33723.15
Mean Distribution
Standard Deviation 209.3222
95.00% Confidence Intervall ( 311606.42 - 312426.94 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4320
0.1 Scale Factor Error with Delta=300 934717
0.05 Scale Factor Error with Delta=300 3738871
0.01 Scale Factor Error with Delta=300 93471778
Priority Target DPS
Sample Data appendages_865 / call_865 Priority Target Damage Per Second
Count 2499
Mean 312016.68
Minimum 268272.45
Maximum 344754.21
Spread ( max - min ) 76481.75
Range [ ( max - min ) / 2 * 100% ] 12.26%
Standard Deviation 10464.0166
5th Percentile 295508.58
95th Percentile 329231.73
( 95th Percentile - 5th Percentile ) 33723.15
Mean Distribution
Standard Deviation 209.3222
95.00% Confidence Intervall ( 311606.42 - 312426.94 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4320
0.1 Scale Factor Error with Delta=300 934717
0.05 Scale Factor Error with Delta=300 3738871
0.01 Scale Factor Error with Delta=300 93471778
DPS(e)
Sample Data appendages_865 / call_865 Damage Per Second (Effective)
Count 2499
Mean 312016.68
Minimum 268272.45
Maximum 344754.21
Spread ( max - min ) 76481.75
Range [ ( max - min ) / 2 * 100% ] 12.26%
Damage
Sample Data appendages_865 / call_865 Damage
Count 2499
Mean 140327788.90
Minimum 99523714.74
Maximum 178846545.84
Spread ( max - min ) 79322831.10
Range [ ( max - min ) / 2 * 100% ] 28.26%
DTPS
Sample Data appendages_865 / call_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data appendages_865 / call_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data appendages_865 / call_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data appendages_865 / call_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data appendages_865 / call_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data appendages_865 / call_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data appendages_865 / call_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data appendages_865 / call_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.56 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.56 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.21 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 4.05 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 49.07 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.31 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.81 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 10.24 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 6.44 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.11 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.56 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.57 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.57 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 107.65 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQCAQIQEMJQQOPELOQQEJQQQQEKOPQCQEJN89QQQEKPQOQEJOPQCQEJOQPEKOQQEJMPELOQQCQEJOPQQEIOQQQEJOPQECJOQQPEIOQPEOJQQQCQEIN89PQQEJMQEKOPOQEJCAOPQQEJQQQQEKOQQPQEJOQQQCEOJPQQEKOQQPEJOQQEKMOCEJPQQQELOPQEJOQPQCEIN89QQQEJPOQQQEJOQPQQEIOCQQQEJOQPQEKMOEJQPQQQELCOQQEDOPQEIODPEOCABQQKQQQPQELOQQELOQQPEKOMCEJN89QPQELQQQOEKODCPQQQELOPQEKO

Sample Sequence Table

time name target resources buffs
Pre flask appendages_865 / call_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food appendages_865 / call_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation appendages_865 / call_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, horrific_appendages, potion_of_the_old_war
0:01.004 lunar_inspiration Fluffy_Pillow 76.2/100: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, horrific_appendages, potion_of_the_old_war
0:02.008 shred Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, horrific_appendages, potion_of_the_old_war
0:03.012 tigers_fury Fluffy_Pillow 34.5/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, horrific_appendages, potion_of_the_old_war
0:03.012 berserk Fluffy_Pillow 94.5/100: 94% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, tigers_fury, horrific_appendages, potion_of_the_old_war
0:03.012 shred Fluffy_Pillow 94.5/150: 63% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, horrific_appendages, potion_of_the_old_war
0:04.016 savage_roar Fluffy_Pillow 103.7/150: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, horrific_appendages, potion_of_the_old_war
0:05.019 shred Fluffy_Pillow 112.8/150: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
0:06.023 healing_touch Fluffy_Pillow 122.0/150: 81% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
0:06.776 ashamanes_frenzy Fluffy_Pillow 132.6/150: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
0:07.781 rip Fluffy_Pillow 146.8/150: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
0:08.785 shred Fluffy_Pillow 145.9/150: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
0:09.790 shred Fluffy_Pillow 140.1/150: 93% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
0:10.794 rake Fluffy_Pillow 134.3/150: 90% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
0:11.798 lunar_inspiration Fluffy_Pillow 131.0/150: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
0:12.803 healing_touch Fluffy_Pillow 130.1/150: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:13.559 ferocious_bite Fluffy_Pillow 140.8/150: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
0:14.564 rake Fluffy_Pillow 142.5/150: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:15.570 shred Fluffy_Pillow 139.2/150: 93% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.576 shred Fluffy_Pillow 133.4/150: 89% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.580 healing_touch Fluffy_Pillow 127.5/150: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.334 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, potion_of_the_old_war
0:19.337 shred Fluffy_Pillow 84.2/100: 84% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.342 shred Fluffy_Pillow 58.3/100: 58% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:21.348 Waiting 0.600 sec 32.5/100: 33% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:21.948 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:22.952 Waiting 1.797 sec 15.2/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:24.749 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:25.753 healing_touch Fluffy_Pillow 14.7/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:26.508 savage_roar Fluffy_Pillow 25.3/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, jacins_ruse
0:27.512 rake Fluffy_Pillow 39.5/100: 39% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
0:28.517 Waiting 0.448 sec 18.7/100: 19% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:28.965 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:29.970 Waiting 0.100 sec 39.2/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:30.070 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:31.076 Waiting 1.725 sec 14.8/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:32.801 tigers_fury Fluffy_Pillow 39.1/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:33.012 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:34.016 healing_touch Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:34.771 rip Fluffy_Pillow 99.8/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
0:35.775 shadowmeld Fluffy_Pillow 99.0/100: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:35.775 rake Fluffy_Pillow 99.0/100: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:35.775 auto_attack Fluffy_Pillow 64.0/100: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:36.780 shred Fluffy_Pillow 93.2/100: 93% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:37.785 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:38.789 shred Fluffy_Pillow 74.2/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:39.794 healing_touch Fluffy_Pillow 48.3/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:40.548 Waiting 2.700 sec 59.0/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:43.248 savage_roar Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:44.252 lunar_inspiration Fluffy_Pillow 60.5/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:45.256 shred Fluffy_Pillow 41.4/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:46.261 Waiting 1.471 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
0:48.499 rake Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
0:49.504 Waiting 2.553 sec 12.5/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:52.057 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:53.062 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:53.987 Waiting 1.356 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
0:55.343 rip Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
0:56.348 rake Fluffy_Pillow 16.8/100: 17% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
0:57.352 Waiting 0.300 sec 27.7/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages
0:57.652 lunar_inspiration Fluffy_Pillow 30.9/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages
0:58.657 Waiting 2.615 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
1:01.272 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
1:02.278 Waiting 1.279 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
1:03.557 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
1:03.557 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:04.561 healing_touch Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
1:05.488 rip Fluffy_Pillow 80.9/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, horrific_appendages
1:06.493 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:07.497 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
1:08.501 lunar_inspiration Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:09.506 healing_touch Fluffy_Pillow 51.8/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:10.433 Waiting 2.600 sec 61.9/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:13.033 savage_roar Fluffy_Pillow 90.1/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing
1:14.037 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:15.042 shred Fluffy_Pillow 75.9/100: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:16.047 shred Fluffy_Pillow 46.8/100: 47% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:17.052 healing_touch Fluffy_Pillow 17.7/100: 18% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:17.976 Waiting 4.800 sec 27.7/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
1:22.776 rip Fluffy_Pillow 79.8/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing
1:23.783 ashamanes_frenzy Fluffy_Pillow 90.8/100: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:24.787 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:25.793 healing_touch Fluffy_Pillow 80.9/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:26.720 ferocious_bite Fluffy_Pillow 91.0/100: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:27.725 rake Fluffy_Pillow 51.9/100: 52% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:28.729 Waiting 1.200 sec 27.8/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:29.929 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:30.933 Waiting 1.225 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:32.158 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
1:33.160 Waiting 0.200 sec 35.9/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:33.360 tigers_fury Fluffy_Pillow 38.0/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
1:33.557 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
1:34.562 healing_touch Fluffy_Pillow 85.9/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
1:35.489 rip Fluffy_Pillow 96.0/100: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
1:36.493 rake Fluffy_Pillow 91.9/100: 92% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
1:37.497 lunar_inspiration Fluffy_Pillow 82.8/100: 83% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
1:38.504 shred Fluffy_Pillow 64.9/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
1:39.508 Waiting 0.300 sec 37.1/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
1:39.808 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
1:40.814 healing_touch Fluffy_Pillow 12.9/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
1:42.921 savage_roar Fluffy_Pillow 38.4/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), cleansed_ancients_blessing, cleansed_sisters_blessing, cleansed_wisps_blessing
1:43.927 rake Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
1:44.931 Waiting 1.100 sec 27.7/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
1:46.031 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
1:47.036 Waiting 1.572 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
1:48.608 shred Fluffy_Pillow 30.9/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:49.613 shred Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:50.618 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:51.544 Waiting 4.006 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:55.550 rip Fluffy_Pillow 66.2/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:56.555 rake Fluffy_Pillow 47.1/100: 47% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:57.559 Waiting 0.680 sec 23.0/100: 23% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:58.239 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:59.242 Waiting 2.661 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:01.903 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:02.908 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:03.833 tigers_fury Fluffy_Pillow 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:03.833 Waiting 0.800 sec 81.1/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:04.633 rip Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:05.636 rake Fluffy_Pillow 85.7/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:06.642 shred Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:07.646 shred Fluffy_Pillow 62.5/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
2:08.651 lunar_inspiration Fluffy_Pillow 33.4/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
2:09.658 healing_touch Fluffy_Pillow 14.3/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
2:12.120 savage_roar Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
2:15.421 rake Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:16.426 Waiting 2.524 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:18.950 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:19.954 Waiting 2.182 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:22.136 lunar_inspiration Fluffy_Pillow 34.8/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:23.140 healing_touch Fluffy_Pillow 15.7/100: 16% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:25.089 rake Fluffy_Pillow 36.8/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar
2:26.094 Waiting 1.131 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
2:27.225 rip Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar
2:28.229 Waiting 0.400 sec 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:28.629 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:29.634 Waiting 2.677 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:32.311 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:33.316 shred Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
2:34.319 tigers_fury Fluffy_Pillow 22.0/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:34.319 shred Fluffy_Pillow 82.0/100: 82% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:35.325 healing_touch Fluffy_Pillow 67.9/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:36.249 savage_roar Fluffy_Pillow 77.9/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
2:37.253 shadowmeld Fluffy_Pillow 63.8/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:37.253 rake Fluffy_Pillow 63.8/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:37.253 auto_attack Fluffy_Pillow 28.8/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:38.259 lunar_inspiration Fluffy_Pillow 54.7/100: 55% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:39.263 shred Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:40.267 shred Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
2:41.272 healing_touch Fluffy_Pillow 17.4/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
2:42.198 Waiting 1.200 sec 27.5/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:43.398 rip Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:44.402 ashamanes_frenzy Fluffy_Pillow 21.4/100: 21% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:45.407 Waiting 0.600 sec 32.8/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:46.007 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:47.012 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:47.840 Waiting 1.927 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
2:49.767 savage_roar Fluffy_Pillow 45.6/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
2:52.308 rake Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:53.312 Waiting 1.449 sec 13.5/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:54.761 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, cleansed_sisters_blessing
2:55.767 rake Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
2:56.771 Waiting 1.565 sec 23.2/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:58.336 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:59.339 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages
3:00.267 Waiting 0.855 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
3:01.122 rip Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
3:04.167 tigers_fury Fluffy_Pillow 33.5/100: 33% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
3:04.319 berserk Fluffy_Pillow 95.1/100: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:04.319 rake Fluffy_Pillow 95.1/150: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:05.324 lunar_inspiration Fluffy_Pillow 103.5/150: 69% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:06.327 shred Fluffy_Pillow 114.4/150: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:07.332 shred Fluffy_Pillow 120.3/150: 80% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:08.336 healing_touch Fluffy_Pillow 111.2/150: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:09.260 rip Fluffy_Pillow 121.2/150: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury
3:10.264 shred Fluffy_Pillow 117.1/150: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury
3:11.267 shred Fluffy_Pillow 128.0/150: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:12.273 shred Fluffy_Pillow 118.9/150: 79% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:13.278 shred Fluffy_Pillow 109.8/150: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:14.282 healing_touch Fluffy_Pillow 100.7/150: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar
3:15.206 savage_roar Fluffy_Pillow 110.8/150: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar
3:16.210 rake Fluffy_Pillow 121.7/150: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar
3:17.215 shred Fluffy_Pillow 115.1/150: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:18.221 shred Fluffy_Pillow 106.0/150: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar
3:19.225 lunar_inspiration Fluffy_Pillow 96.9/150: 65% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, cleansed_wisps_blessing
3:20.229 shred Fluffy_Pillow 92.8/100: 93% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
3:21.232 healing_touch Fluffy_Pillow 63.7/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
3:22.157 Waiting 1.500 sec 73.7/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing
3:23.657 rip Fluffy_Pillow 90.0/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing
3:24.662 rake Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:25.667 shred Fluffy_Pillow 46.8/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:26.673 Waiting 2.070 sec 17.7/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:28.743 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:29.748 Waiting 2.681 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:32.429 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:33.432 Waiting 1.283 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:34.715 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:34.715 healing_touch Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:35.641 rake Fluffy_Pillow 95.0/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
3:36.647 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
3:37.652 lunar_inspiration Fluffy_Pillow 95.9/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:38.658 shred Fluffy_Pillow 91.8/100: 92% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
3:39.663 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
3:40.668 healing_touch Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
3:41.595 Waiting 0.800 sec 81.0/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
3:42.395 savage_roar Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
3:43.402 rake Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:44.406 shred Fluffy_Pillow 71.5/100: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:45.411 shred Fluffy_Pillow 42.4/100: 42% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:46.417 Waiting 1.578 sec 13.3/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:47.995 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
3:48.999 healing_touch Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:49.925 Waiting 3.500 sec 51.4/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:53.425 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:54.431 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:55.436 shred Fluffy_Pillow 46.2/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:56.440 Waiting 2.130 sec 17.1/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:58.570 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:59.574 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:00.498 Waiting 1.758 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:02.256 savage_roar Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:03.261 ashamanes_frenzy Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:04.266 rake Fluffy_Pillow 22.0/100: 22% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:05.272 tigers_fury Fluffy_Pillow 32.9/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:05.272 healing_touch Fluffy_Pillow 92.9/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:06.197 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:07.200 lunar_inspiration Fluffy_Pillow 95.9/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:08.205 shred Fluffy_Pillow 91.8/100: 92% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:09.209 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:10.213 shred Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:11.217 healing_touch Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
4:12.143 Waiting 3.500 sec 51.8/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
4:15.643 ferocious_bite Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:16.647 rake Fluffy_Pillow 75.7/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:17.651 lunar_inspiration Fluffy_Pillow 51.6/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:18.657 Waiting 0.700 sec 32.5/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:19.357 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:20.363 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:21.289 Waiting 3.959 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
4:25.248 rip Fluffy_Pillow 64.1/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
4:26.251 rake Fluffy_Pillow 45.0/100: 45% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:27.256 Waiting 1.781 sec 20.9/100: 21% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:29.037 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:30.041 Waiting 1.782 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:31.823 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:32.826 Waiting 1.261 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:34.087 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
4:35.093 tigers_fury Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:35.272 healing_touch Fluffy_Pillow 97.9/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:36.199 savage_roar Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
4:37.204 shadowmeld Fluffy_Pillow 85.9/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:37.253 rake Fluffy_Pillow 86.4/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, clearcasting, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:37.253 auto_attack Fluffy_Pillow 86.4/100: 86% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:38.258 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:39.261 shred Fluffy_Pillow 85.9/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:40.265 shred Fluffy_Pillow 56.8/100: 57% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:41.271 healing_touch Fluffy_Pillow 27.7/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:42.196 Waiting 1.000 sec 37.7/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:43.196 rip Fluffy_Pillow 48.6/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:44.201 Waiting 0.800 sec 29.5/100: 29% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:45.001 lunar_inspiration Fluffy_Pillow 38.2/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:46.005 Waiting 1.345 sec 19.1/100: 19% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:47.605 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:48.610 Waiting 1.565 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:50.175 shred Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
4:51.179 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:52.184 shred Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
4:53.188 healing_touch Fluffy_Pillow 22.0/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:54.114 Waiting 2.100 sec 32.1/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:56.214 rip Fluffy_Pillow 54.9/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:57.219 rake Fluffy_Pillow 65.8/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:58.225 shred Fluffy_Pillow 76.7/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:59.230 lunar_inspiration Fluffy_Pillow 47.6/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
5:00.235 shred Fluffy_Pillow 58.5/100: 59% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness
5:01.240 shred Fluffy_Pillow 69.4/100: 69% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
5:02.245 healing_touch Fluffy_Pillow 80.3/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
5:03.171 savage_roar Fluffy_Pillow 90.4/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
5:04.176 rake Fluffy_Pillow 61.3/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:05.181 tigers_fury Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:05.272 shred Fluffy_Pillow 98.2/100: 98% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:06.276 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:07.281 shred Fluffy_Pillow 85.9/100: 86% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:08.286 healing_touch Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:09.212 Waiting 0.700 sec 81.9/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:09.912 rip Fluffy_Pillow 89.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:10.917 rake Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:11.922 shred Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
5:12.927 Waiting 1.220 sec 17.2/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:14.147 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:15.152 Waiting 1.759 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:16.911 shred Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
5:17.916 healing_touch Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:18.842 Waiting 0.400 sec 51.4/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
5:19.242 savage_roar Fluffy_Pillow 55.7/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
5:20.245 ashamanes_frenzy Fluffy_Pillow 66.6/100: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:21.250 rake Fluffy_Pillow 77.5/100: 78% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:22.255 healing_touch Fluffy_Pillow 53.4/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:23.179 Waiting 2.400 sec 63.4/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:25.579 rip Fluffy_Pillow 89.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:26.584 shred Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:27.587 lunar_inspiration Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:28.593 Waiting 1.158 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:29.751 shred Fluffy_Pillow 34.8/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
5:30.755 shred Fluffy_Pillow 45.7/100: 46% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:31.761 Waiting 1.675 sec 16.6/100: 17% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:33.436 shred Fluffy_Pillow 34.8/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:34.439 healing_touch Fluffy_Pillow 45.6/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:35.363 ferocious_bite Fluffy_Pillow 55.7/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:36.368 tigers_fury Fluffy_Pillow 16.6/100: 17% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:36.368 rake Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:37.373 shred Fluffy_Pillow 67.5/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:38.376 shred Fluffy_Pillow 53.4/100: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
5:39.380 healing_touch Fluffy_Pillow 39.3/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
5:40.306 Waiting 3.200 sec 49.3/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_ancients_blessing
5:43.506 ferocious_bite Fluffy_Pillow 84.0/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_ancients_blessing
5:44.510 rake Fluffy_Pillow 44.9/100: 45% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, cleansed_ancients_blessing
5:45.516 Waiting 0.881 sec 20.9/100: 21% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, cleansed_ancients_blessing
5:46.397 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, cleansed_ancients_blessing
5:47.403 Waiting 2.659 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages, cleansed_ancients_blessing
5:50.062 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:51.067 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, horrific_appendages
5:53.781 savage_roar Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), horrific_appendages
5:57.088 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:58.094 Waiting 1.564 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:59.658 ferocious_bite Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
6:00.663 Waiting 1.798 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
6:02.461 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
6:03.465 Waiting 1.260 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:04.725 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:05.649 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:06.653 tigers_fury Fluffy_Pillow 10.9/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, savage_roar, jacins_ruse
6:06.653 berserk Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
6:06.653 potion Fluffy_Pillow 70.9/150: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, jacins_ruse
6:06.653 shred Fluffy_Pillow 70.9/150: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:07.657 shred Fluffy_Pillow 96.8/150: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:08.663 savage_roar Fluffy_Pillow 102.7/150: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:09.667 shred Fluffy_Pillow 108.6/150: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:10.671 shred Fluffy_Pillow 99.5/150: 66% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:11.677 shred Fluffy_Pillow 90.4/150: 60% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:12.682 lunar_inspiration Fluffy_Pillow 81.3/150: 54% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:13.687 shred Fluffy_Pillow 77.3/150: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:14.693 healing_touch Fluffy_Pillow 68.2/150: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:15.618 ferocious_bite Fluffy_Pillow 78.2/150: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:16.622 rake Fluffy_Pillow 64.1/150: 43% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:17.627 shred Fluffy_Pillow 75.0/150: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:18.630 shred Fluffy_Pillow 65.9/150: 44% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:19.634 healing_touch Fluffy_Pillow 56.8/150: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse, potion_of_the_old_war
6:20.561 ferocious_bite Fluffy_Pillow 66.9/150: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
6:21.564 rake Fluffy_Pillow 52.7/150: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:22.568 shred Fluffy_Pillow 46.1/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:23.572 Waiting 2.034 sec 17.0/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:25.606 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
6:26.609 Waiting 1.481 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
6:28.090 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
6:29.094 healing_touch Fluffy_Pillow 13.2/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
6:29.925 Waiting 3.243 sec 23.3/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
6:33.168 savage_roar Fluffy_Pillow 62.5/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse
6:34.430 rake Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
6:35.435 ashamanes_frenzy Fluffy_Pillow 13.3/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:36.439 tigers_fury Fluffy_Pillow 24.2/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:36.653 healing_touch Fluffy_Pillow 86.5/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:37.579 rip Fluffy_Pillow 96.6/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
6:38.583 shadowmeld Fluffy_Pillow 92.5/100: 92% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
6:38.583 rake Fluffy_Pillow 92.5/100: 92% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
6:38.583 auto_attack Fluffy_Pillow 57.5/100: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
6:39.587 shred Fluffy_Pillow 83.4/100: 83% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
6:40.591 lunar_inspiration Fluffy_Pillow 69.3/100: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
6:41.594 shred Fluffy_Pillow 50.2/100: 50% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
6:42.598 healing_touch Fluffy_Pillow 61.1/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
6:43.524 Waiting 1.700 sec 71.1/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, horrific_appendages, jacins_ruse
6:45.224 ferocious_bite Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
6:46.226 shred Fluffy_Pillow 75.4/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
6:47.232 shred Fluffy_Pillow 46.4/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
6:48.237 Waiting 2.112 sec 17.3/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
6:50.349 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:51.352 Waiting 1.283 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:53.659 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:54.665 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:55.590 Waiting 6.270 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:01.860 savage_roar Fluffy_Pillow 90.1/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:02.865 rake Fluffy_Pillow 61.0/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:03.869 ferocious_bite Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
7:04.872 Waiting 1.600 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:06.472 tigers_fury Fluffy_Pillow 28.2/100: 28% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, horrific_appendages
7:06.653 lunar_inspiration Fluffy_Pillow 90.2/100: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
7:07.656 shred Fluffy_Pillow 86.1/100: 86% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
7:08.660 shred Fluffy_Pillow 72.0/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
7:09.663 shred Fluffy_Pillow 57.9/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
7:10.666 healing_touch Fluffy_Pillow 28.8/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
7:11.593 Waiting 4.700 sec 38.8/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, horrific_appendages
7:16.293 ferocious_bite Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages
7:17.297 rake Fluffy_Pillow 75.7/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:18.301 lunar_inspiration Fluffy_Pillow 51.6/100: 52% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:19.306 Waiting 0.700 sec 32.5/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:20.006 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:21.007 healing_touch Fluffy_Pillow 11.0/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:21.933 Waiting 3.964 sec 21.0/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:25.897 savage_roar Fluffy_Pillow 64.1/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:27.155 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:28.162 Waiting 1.946 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 34.71% 34.71% 6549
Haste 8.53% 8.53% 2771
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 21649 19943 0
Mastery 59.20% 57.06% 7186
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 847.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Spontaneous Appendages
ilevel: 865, stats: { +986 Mastery }
Local Trinket2 Nature's Call
ilevel: 865, stats: { +329 Mastery, +329 Haste, +329 Crit }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="appendages_865 / call_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=spontaneous_appendages,id=139325,bonus_id=1805
trinket2=natures_call,id=139334,bonus_id=1805
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=846.88
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=6549
# gear_haste_rating=1847
# gear_mastery_rating=7186
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

appendages_865 / pod_865 : 312259 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
312258.9 312258.9 393.8 / 0.126% 38736.5 / 12.4% 20975.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.9 14.9 Energy 30.64% 44.2 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
appendages_865 / pod_865 312259
Ashamane's Frenzy 14409 4.6% 6.1 78.65sec 1060230 1055507 Direct 91.4 9861 19726 13203 33.9%  
Periodic 30.2 130415 261063 174604 33.8% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.11 91.42 121.63 30.21 1.0045 0.6471 6481869.69 7049293.45 8.05 76394.80 1055507.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.46 66.13% 9861.48 7343 11706 9864.00 8590 10744 596188 876452 31.98
crit 30.97 33.87% 19726.27 14686 23411 19724.88 17497 21668 610854 898013 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.0 66.18% 130414.96 80962 161329 130441.19 114544 145936 2607356 2607356 0.00
crit 10.2 33.82% 261062.51 161924 322658 261036.31 221531 304473 2667473 2667473 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 35891 11.5% 18.7 22.56sec 865640 0 Periodic 146.4 82505 164924 110297 33.7% 41.9%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.66 0.00 146.43 146.43 0.0000 1.2891 16151342.56 16151342.56 0.00 85564.59 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.1 66.28% 82505.29 57 97721 82418.99 73485 89948 8007313 8007313 0.00
crit 49.4 33.72% 164923.69 114 195442 164744.44 140866 186917 8144030 8144030 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 27905 8.9% 514.3 0.87sec 24410 27973 Direct 514.3 18233 36469 24410 33.9%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 514.32 514.32 0.00 0.00 0.8726 0.0000 12554508.67 18456316.93 31.98 27972.94 27972.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 340.12 66.13% 18232.93 14216 20436 18232.62 17777 18516 6201365 9116594 31.98
crit 174.21 33.87% 36468.87 28433 40872 36467.26 35305 37386 6353144 9339723 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6270 2.0% 10.6 44.57sec 266641 265450 Direct 10.6 188879 420607 266653 33.6%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.56 10.56 0.00 0.00 1.0045 0.0000 2815898.38 4139637.35 31.98 265450.45 265450.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.02 66.44% 188878.53 15027 251221 188797.99 90358 238933 1325112 1948040 31.98
crit 3.54 33.56% 420606.83 33609 555198 413544.29 0 555198 1490786 2191597 31.49
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Horrific Slam 7150 2.3% 101.8 3.48sec 31605 0 Direct 101.8 23613 47237 31605 33.8%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.81 101.81 0.00 0.00 0.0000 0.0000 3217592.53 3217592.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.36 66.17% 23613.21 18381 26423 23610.72 21777 25363 1590674 1590674 0.00
crit 34.44 33.83% 47236.97 36763 52846 47235.65 42653 51123 1626918 1626918 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16532.30
  • base_dd_max:18272.54
 
Infested Ground 5277 1.7% 7.9 60.66sec 302083 0 Direct 77.7 22840 45676 30565 33.8%  

Stats details: infested_ground

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.86 77.67 0.00 0.00 0.0000 0.0000 2374111.66 2374111.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.40 66.17% 22839.74 16725 24042 22839.99 21706 23520 1173920 1173920 0.00
crit 26.28 33.83% 45675.54 33450 48085 45681.18 42776 47786 1200191 1200191 0.00
 
 

Action details: infested_ground

Static Values
  • id:221803
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221803
  • name:Infested Ground
  • school:shadow
  • tooltip:
  • description:Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.
 
Moonfire (lunar_inspiration) 22296 7.1% 31.6 14.34sec 317249 315833 Direct 31.6 33020 66031 44182 33.8%  
Periodic 253.7 25450 50910 34036 33.7% 96.9%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.62 31.62 253.68 253.68 1.0045 1.7191 10031496.27 10031496.27 0.00 21440.50 315833.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.93 66.19% 33020.28 25727 36982 33018.80 30427 35173 691057 691057 0.00
crit 10.69 33.81% 66031.49 51454 73964 66008.35 57885 72357 705976 705976 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 168.1 66.28% 25450.40 98 28764 25450.11 24724 26143 4278967 4278967 0.00
crit 85.6 33.72% 50910.35 195 57529 50907.19 47238 52825 4355497 4355497 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2219 0.7% 24.5 18.27sec 40702 0 Periodic 72.5 13766 0 13766 0.0% 8.0%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.53 0.00 72.52 72.52 0.0000 0.4970 998373.37 1467703.43 31.98 27701.81 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.5 100.00% 13766.12 31 15493 13769.68 12845 14707 998373 1467703 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11236 3.6% 23.8 17.03sec 209931 0 Direct 23.8 156639 313724 209917 33.9%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.78 23.78 0.00 0.00 0.0000 0.0000 4991899.99 7338565.84 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.71 66.07% 156639.41 122075 175482 156615.71 143874 168439 2461000 3617904 31.98
crit 8.07 33.93% 313723.77 244149 350964 313625.77 264495 350964 2530900 3720662 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 68425 21.9% 47.2 9.56sec 652033 649125 Direct 47.2 84533 168760 113130 34.0%  
Periodic 223.7 85030 170146 113762 33.8% 94.9%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.22 47.22 223.66 223.66 1.0045 1.9087 30786711.60 30786711.60 0.00 64905.00 649125.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.19 66.05% 84532.62 39701 189864 84549.62 71708 95778 2636177 2636177 0.00
crit 16.03 33.95% 168759.99 79402 379727 168774.92 133735 220868 2705480 2705480 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.2 66.24% 85029.79 37 189864 85058.19 75326 94152 12597827 12597827 0.00
crit 75.5 33.76% 170146.22 85 379727 170207.75 145978 200395 12847228 12847228 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 82213 26.4% 22.9 15.52sec 1619601 1612414 Periodic 326.5 84795 169590 113366 33.7% 96.1%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.85 0.00 326.49 326.49 1.0045 1.3246 37012973.00 37012973.00 0.00 81270.21 1612414.42
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 216.5 66.30% 84795.21 66 97721 84788.07 78724 88580 18355942 18355942 0.00
crit 110.0 33.70% 169589.95 229 195442 169576.26 155405 177812 18657031 18657031 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 28968 9.3% 110.0 4.08sec 118324 117794 Direct 110.0 88439 176900 118320 33.8%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.04 110.04 0.00 0.00 1.0045 0.0000 13020244.61 19140992.89 31.98 117794.02 117794.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.87 66.22% 88438.51 61977 133637 88456.65 82949 93966 6444159 9473524 31.98
crit 37.17 33.78% 176899.81 123954 267275 176805.18 161048 197786 6576086 9667469 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
appendages_865 / pod_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:appendages_865 / pod_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 181.96sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:appendages_865 / pod_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:appendages_865 / pod_865
  • harmful:false
  • if_expr:
 
Healing Touch 50.2 9.08sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.19 0.00 0.00 0.00 0.8661 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.6 24.72sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.55 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.75sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.33sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.18% 45.4(45.4) 15.1

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 14.91% 0.0(0.0) 2.9

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 50.2 0.0 9.0sec 9.1sec 45.58% 45.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.78%
  • bloodtalons_2:26.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 43.6 1.4 10.2sec 9.8sec 6.33% 15.23% 1.4(1.4) 0.0

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.33%

Trigger Attempt Success

  • trigger_pct:8.75%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Horrific Appendages 5.8 1.0 71.5sec 59.2sec 17.19% 17.27% 102.8(102.8) 5.6

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:17.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Jacin's Ruse 6.7 1.8 63.7sec 48.4sec 24.73% 24.81% 1.8(1.8) 6.4

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Leeching Pestilence 7.9 0.0 60.7sec 60.7sec 17.29% 17.37% 0.0(0.0) 7.7

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_leeching_pestilence
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:leech_rating
  • amount:1771.29

Stack Uptimes

  • leeching_pestilence_1:17.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221805
  • name:Leeching Pestilence
  • tooltip:Leech increased by $w1.
  • description:{$@spelldesc221803=Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 352.9sec 0.0sec 10.81% 10.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 49.9 1.3 9.0sec 8.8sec 74.56% 74.57% 1.3(1.3) 0.0

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.56%

Trigger Attempt Success

  • trigger_pct:98.38%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.2 10.3 47.8sec 24.7sec 93.32% 93.06% 202.3(202.3) 7.2

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.9sec 133.9sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.81% 29.14% 0.0(0.0) 14.9

Buff details

  • buff initial source:appendages_865 / pod_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
appendages_865 / pod_865
ferocious_bite Energy 21.1 357.7 16.9 33.9 7873.3
ferocious_bite Combo Points 10.6 48.6 4.6 4.6 57882.3
lunar_inspiration Energy 31.6 784.2 24.8 24.8 12792.3
rake Energy 47.2 1345.1 28.5 28.5 22888.9
rip Energy 22.9 464.1 20.3 20.3 79753.1
rip Combo Points 22.9 114.3 5.0 5.0 323917.7
savage_roar Energy 18.6 478.4 25.8 25.8 0.0
savage_roar Combo Points 18.6 92.8 5.0 5.0 0.0
shred Energy 110.0 3266.1 29.7 29.7 3986.5
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.22 47.22 (18.23%) 1.00 0.00 0.00%
tigers_fury Energy 15.22 912.45 (11.21%) 59.97 0.50 0.05%
ashamanes_frenzy Combo Points 6.11 18.34 (7.08%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.62 31.62 (12.21%) 1.00 0.00 0.00%
shred Combo Points 110.04 110.04 (42.49%) 1.00 0.00 0.00%
energy_regen Energy 2164.29 5079.93 (62.39%) 2.35 72.01 1.40%
clearcasting Energy 43.53 1486.96 (18.26%) 34.16 0.00 0.00%
ashamanes_energy Energy 45.45 662.84 (8.14%) 14.59 18.85 2.77%
primal_fury Combo Points 63.89 51.75 (19.98%) 0.81 12.14 19.00%
Resource RPS-Gain RPS-Loss
Energy 14.79 14.88
Combo Points 0.58 0.57
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 36.04 0.02 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.12 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
clearcasting 45.0 9.8sec
clearcasting_wasted 1.4 123.6sec
primal_fury 63.9 7.0sec

Statistics & Data Analysis

Fight Length
Sample Data appendages_865 / pod_865 Fight Length
Count 2499
Mean 450.05
Minimum 360.07
Maximum 539.96
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data appendages_865 / pod_865 Damage Per Second
Count 2499
Mean 312258.94
Minimum 279228.07
Maximum 350677.28
Spread ( max - min ) 71449.21
Range [ ( max - min ) / 2 * 100% ] 11.44%
Standard Deviation 10043.5642
5th Percentile 295516.89
95th Percentile 329218.77
( 95th Percentile - 5th Percentile ) 33701.88
Mean Distribution
Standard Deviation 200.9115
95.00% Confidence Intervall ( 311865.16 - 312652.72 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3974
0.1 Scale Factor Error with Delta=300 861111
0.05 Scale Factor Error with Delta=300 3444445
0.01 Scale Factor Error with Delta=300 86111149
Priority Target DPS
Sample Data appendages_865 / pod_865 Priority Target Damage Per Second
Count 2499
Mean 312258.94
Minimum 279228.07
Maximum 350677.28
Spread ( max - min ) 71449.21
Range [ ( max - min ) / 2 * 100% ] 11.44%
Standard Deviation 10043.5642
5th Percentile 295516.89
95th Percentile 329218.77
( 95th Percentile - 5th Percentile ) 33701.88
Mean Distribution
Standard Deviation 200.9115
95.00% Confidence Intervall ( 311865.16 - 312652.72 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3974
0.1 Scale Factor Error with Delta=300 861111
0.05 Scale Factor Error with Delta=300 3444445
0.01 Scale Factor Error with Delta=300 86111149
DPS(e)
Sample Data appendages_865 / pod_865 Damage Per Second (Effective)
Count 2499
Mean 312258.94
Minimum 279228.07
Maximum 350677.28
Spread ( max - min ) 71449.21
Range [ ( max - min ) / 2 * 100% ] 11.44%
Damage
Sample Data appendages_865 / pod_865 Damage
Count 2499
Mean 140437022.33
Minimum 104742363.06
Maximum 182231717.18
Spread ( max - min ) 77489354.13
Range [ ( max - min ) / 2 * 100% ] 27.59%
DTPS
Sample Data appendages_865 / pod_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data appendages_865 / pod_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data appendages_865 / pod_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data appendages_865 / pod_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data appendages_865 / pod_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data appendages_865 / pod_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data appendages_865 / pod_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data appendages_865 / pod_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.56 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.56 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 7.86 use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
C 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
D 15.22 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
E 4.04 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
F 49.18 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
J 8.21 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
K 22.85 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
L 10.34 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
M 6.52 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
N 6.11 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
O 3.56 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
P 42.65 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
Q 31.62 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
R 110.04 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789QRDABRRJRRFNKPQRFMPRRRFKRRRQFLPRDRFKO89RRQFMRRRFKPQRRFJDBPRRRFKPQRFPJNQFKDPRRRFKPQRRFLPQPFKRDBRRRRFKPQRFPJQPRRFKPRDRRFKO89QRRFJNQFKPRDABRQFPKRRRRFJPRRFMQRRRRFKPRQDRFKPRRRFJPQPRFKRRQRFLDBNPFKRRRRFMPQRRRFKPQDRRFJO89RQFKRPRRFPJQDBRRRFKPRRFKNQFLPRRQFKDPRRFKPRRQFLPRRRFEPQDABCRRFLPRRRFEPQRRFMRRRFMPQRRRFLDNO89RFMQRRFLPQPERRDBRRFMPQRRFLPR

Sample Sequence Table

time name target resources buffs
Pre flask appendages_865 / pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food appendages_865 / pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation appendages_865 / pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.008 shred Fluffy_Pillow 61.1/100: 61% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:03.013 tigers_fury Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, potion_of_the_old_war
0:03.013 berserk Fluffy_Pillow 95.7/100: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:03.013 use_item_ravaged_seed_pod Fluffy_Pillow 95.7/150: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:03.013 shred Fluffy_Pillow 95.7/150: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:04.017 shred Fluffy_Pillow 105.3/150: 70% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:05.022 savage_roar Fluffy_Pillow 114.8/150: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:06.027 shred Fluffy_Pillow 124.4/150: 83% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:07.030 shred Fluffy_Pillow 119.0/150: 79% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:08.036 healing_touch Fluffy_Pillow 113.5/150: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:08.790 ashamanes_frenzy Fluffy_Pillow 124.5/150: 83% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:09.793 rip Fluffy_Pillow 139.0/150: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons, berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:10.797 rake Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:11.803 lunar_inspiration Fluffy_Pillow 147.1/150: 98% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
0:12.809 shred Fluffy_Pillow 146.7/150: 98% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
0:13.814 healing_touch Fluffy_Pillow 141.3/150: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:14.570 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
0:15.574 rake Fluffy_Pillow 139.6/150: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.578 shred Fluffy_Pillow 136.6/150: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.584 shred Fluffy_Pillow 131.2/150: 87% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.589 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:19.594 healing_touch Fluffy_Pillow 74.6/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.350 rip Fluffy_Pillow 85.5/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, potion_of_the_old_war
0:21.355 shred Fluffy_Pillow 70.1/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.360 shred Fluffy_Pillow 44.7/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.364 shred Fluffy_Pillow 19.2/100: 19% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:24.368 Waiting 0.500 sec 33.8/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.868 lunar_inspiration Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:25.872 healing_touch Fluffy_Pillow 25.6/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:26.626 Waiting 0.600 sec 36.6/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:27.226 savage_roar Fluffy_Pillow 45.3/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:29.510 rake Fluffy_Pillow 38.4/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:30.517 Waiting 1.583 sec 18.0/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:32.100 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:33.105 tigers_fury Fluffy_Pillow 15.5/100: 16% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:33.105 shred Fluffy_Pillow 75.5/100: 76% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.109 healing_touch Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.864 rip Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:35.868 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.868 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.868 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.872 shred Fluffy_Pillow 94.6/100: 95% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:37.876 shred Fluffy_Pillow 69.1/100: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury
0:38.881 lunar_inspiration Fluffy_Pillow 83.7/100: 84% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.885 healing_touch Fluffy_Pillow 68.3/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:40.639 Waiting 0.800 sec 79.2/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:41.439 ferocious_bite Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:42.444 shred Fluffy_Pillow 75.3/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
0:43.448 shred Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:44.453 Waiting 2.050 sec 17.7/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:46.503 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:47.506 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:48.405 Waiting 0.784 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:49.189 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:52.493 rake Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
0:53.497 Waiting 1.518 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness
0:55.015 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness
0:56.018 Waiting 2.586 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
0:58.604 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
0:59.607 shred Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
1:00.611 healing_touch Fluffy_Pillow 23.0/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
1:02.278 savage_roar Fluffy_Pillow 41.6/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
1:03.283 tigers_fury Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:03.283 use_item_ravaged_seed_pod Fluffy_Pillow 72.8/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:03.283 rake Fluffy_Pillow 72.8/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:04.288 shred Fluffy_Pillow 64.0/100: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:05.292 shred Fluffy_Pillow 50.2/100: 50% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:06.296 Waiting 0.400 sec 36.4/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
1:06.696 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
1:07.701 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
1:08.603 Waiting 1.555 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
1:10.158 rip Fluffy_Pillow 39.5/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
1:12.697 rake Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
1:13.702 Waiting 1.482 sec 14.0/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:15.184 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:16.188 Waiting 2.586 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:18.774 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:19.779 Waiting 1.180 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:20.959 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:21.860 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:22.864 Waiting 3.433 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, jacins_ruse
1:26.297 savage_roar Fluffy_Pillow 49.5/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons
1:27.302 ashamanes_frenzy Fluffy_Pillow 20.8/100: 21% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:28.307 lunar_inspiration Fluffy_Pillow 32.0/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:29.312 healing_touch Fluffy_Pillow 13.2/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:30.213 Waiting 0.658 sec 23.2/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:30.871 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:33.152 tigers_fury Fluffy_Pillow 26.0/100: 26% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:33.283 rake Fluffy_Pillow 87.5/100: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:34.287 shred Fluffy_Pillow 78.7/100: 79% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:35.292 shred Fluffy_Pillow 64.9/100: 65% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:36.298 shred Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:37.302 healing_touch Fluffy_Pillow 62.3/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:38.201 Waiting 1.500 sec 72.3/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
1:39.701 rip Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
1:40.705 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:41.711 lunar_inspiration Fluffy_Pillow 46.5/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:42.716 Waiting 1.200 sec 27.7/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:43.916 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:44.919 Waiting 2.539 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:47.458 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:48.461 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:49.360 Waiting 0.884 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:50.244 savage_roar Fluffy_Pillow 31.7/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:51.249 rake Fluffy_Pillow 42.9/100: 43% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:52.253 Waiting 1.028 sec 19.1/100: 19% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:53.281 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:54.285 Waiting 2.386 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
1:56.671 rake Fluffy_Pillow 38.4/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
1:57.674 healing_touch Fluffy_Pillow 14.6/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:58.573 Waiting 1.800 sec 24.6/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:00.373 rip Fluffy_Pillow 44.7/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:01.377 Waiting 1.300 sec 25.9/100: 26% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:02.677 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:03.680 tigers_fury Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:03.680 use_item_ravaged_seed_pod Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:03.680 shred Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:04.684 shred Fluffy_Pillow 57.8/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:05.690 shred Fluffy_Pillow 84.0/100: 84% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:06.695 shred Fluffy_Pillow 70.2/100: 70% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:07.700 healing_touch Fluffy_Pillow 41.4/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:08.600 rip Fluffy_Pillow 51.5/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:09.858 rake Fluffy_Pillow 35.5/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:10.862 Waiting 1.692 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:12.554 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
2:13.558 Waiting 2.585 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
2:16.143 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, jacins_ruse
2:17.147 Waiting 1.982 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, jacins_ruse
2:19.129 healing_touch Fluffy_Pillow 33.9/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, jacins_ruse
2:20.030 rake Fluffy_Pillow 44.0/100: 44% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), jacins_ruse
2:21.035 savage_roar Fluffy_Pillow 20.2/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, horrific_appendages, jacins_ruse
2:22.039 Waiting 0.400 sec 31.4/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:22.439 lunar_inspiration Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:23.699 rake Fluffy_Pillow 19.9/100: 20% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:24.704 Waiting 0.800 sec 31.1/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:25.504 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:26.509 Waiting 2.532 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:29.041 shred Fluffy_Pillow 39.5/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages
2:30.047 healing_touch Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages
2:30.951 rip Fluffy_Pillow 60.8/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages
2:31.956 rake Fluffy_Pillow 72.0/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
2:32.960 shred Fluffy_Pillow 48.2/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:33.964 tigers_fury Fluffy_Pillow 19.4/100: 19% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:33.964 shred Fluffy_Pillow 79.4/100: 79% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:34.969 shred Fluffy_Pillow 65.6/100: 66% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:35.974 healing_touch Fluffy_Pillow 51.8/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:36.874 Waiting 1.100 sec 61.9/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
2:37.974 rip Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
2:38.978 shadowmeld Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:38.978 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:38.978 auto_attack Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:39.981 lunar_inspiration Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:40.987 Waiting 1.100 sec 27.8/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:42.087 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:43.092 Waiting 2.633 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:45.725 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, jacins_ruse
2:46.730 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, jacins_ruse
2:49.417 savage_roar Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
2:50.421 ashamanes_frenzy Fluffy_Pillow 13.0/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
2:51.423 Waiting 0.600 sec 24.2/100: 24% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:52.023 lunar_inspiration Fluffy_Pillow 30.9/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:53.028 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, predatory_swiftness, savage_roar
2:53.927 Waiting 0.758 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:54.685 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:57.994 rake Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:58.998 Waiting 2.414 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:01.412 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages
3:02.418 Waiting 1.379 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
3:03.797 tigers_fury Fluffy_Pillow 27.2/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
3:03.964 berserk Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:03.964 use_item_ravaged_seed_pod Fluffy_Pillow 89.1/150: 59% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:03.964 shred Fluffy_Pillow 89.1/150: 59% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:04.969 lunar_inspiration Fluffy_Pillow 95.3/150: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:05.972 healing_touch Fluffy_Pillow 121.5/150: 81% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:06.874 rake Fluffy_Pillow 131.5/150: 88% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:07.878 rip Fluffy_Pillow 140.2/150: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, berserk, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:08.883 shred Fluffy_Pillow 136.5/150: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:09.886 shred Fluffy_Pillow 127.6/150: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:10.890 shred Fluffy_Pillow 118.8/150: 79% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:11.895 shred Fluffy_Pillow 110.1/150: 73% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
3:12.898 healing_touch Fluffy_Pillow 101.2/150: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence
3:13.797 savage_roar Fluffy_Pillow 111.3/150: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, leeching_pestilence
3:14.801 rake Fluffy_Pillow 102.5/150: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar
3:15.807 shred Fluffy_Pillow 96.2/150: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:16.812 shred Fluffy_Pillow 87.4/150: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:17.817 healing_touch Fluffy_Pillow 78.6/150: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:18.717 ferocious_bite Fluffy_Pillow 88.7/150: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:19.723 lunar_inspiration Fluffy_Pillow 74.9/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:20.728 shred Fluffy_Pillow 56.1/100: 56% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:21.732 shred Fluffy_Pillow 27.3/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
3:22.734 Waiting 0.200 sec 38.5/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:22.934 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:23.937 Waiting 2.574 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:26.511 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
3:27.519 healing_touch Fluffy_Pillow 51.9/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
3:28.419 rip Fluffy_Pillow 61.9/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:29.422 rake Fluffy_Pillow 73.1/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:30.426 shred Fluffy_Pillow 49.3/100: 49% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:31.431 Waiting 1.003 sec 20.5/100: 20% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:32.434 lunar_inspiration Fluffy_Pillow 31.7/100: 32% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:33.438 Waiting 1.085 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:34.523 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:34.523 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:35.527 healing_touch Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:36.428 rip Fluffy_Pillow 81.2/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
3:37.432 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:38.438 shred Fluffy_Pillow 91.2/100: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury, jacins_ruse
3:39.442 shred Fluffy_Pillow 62.4/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury, jacins_ruse
3:40.446 Waiting 0.600 sec 33.6/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury, jacins_ruse
3:41.046 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury, jacins_ruse
3:42.052 healing_touch Fluffy_Pillow 11.5/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, jacins_ruse
3:44.737 savage_roar Fluffy_Pillow 41.5/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
3:47.786 rake Fluffy_Pillow 35.5/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:48.790 Waiting 1.691 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:50.481 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:51.485 Waiting 1.185 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:52.670 rake Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
3:53.674 Waiting 0.400 sec 36.2/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:54.074 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:55.079 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:55.978 Waiting 1.378 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:57.356 rip Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
3:58.361 shred Fluffy_Pillow 48.5/100: 48% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:59.366 shred Fluffy_Pillow 59.7/100: 60% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:00.370 lunar_inspiration Fluffy_Pillow 30.9/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:01.377 Waiting 1.154 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:02.531 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
4:03.537 healing_touch Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:04.437 savage_roar Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:05.441 tigers_fury Fluffy_Pillow 17.5/100: 17% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
4:05.441 use_item_ravaged_seed_pod Fluffy_Pillow 77.5/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:05.441 ashamanes_frenzy Fluffy_Pillow 77.5/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
4:06.446 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
4:07.452 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
4:08.352 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
4:09.357 shred Fluffy_Pillow 96.2/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:10.362 shred Fluffy_Pillow 67.4/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:11.365 shred Fluffy_Pillow 38.6/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:12.370 shred Fluffy_Pillow 49.8/100: 50% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:13.377 healing_touch Fluffy_Pillow 61.1/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:14.277 Waiting 1.600 sec 71.1/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, leeching_pestilence
4:15.877 ferocious_bite Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:16.881 rake Fluffy_Pillow 50.1/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:17.885 Waiting 0.400 sec 26.3/100: 26% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:18.285 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:19.289 Waiting 2.564 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:21.853 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:22.857 shred Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
4:23.863 Waiting 1.576 sec 23.0/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:25.439 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:26.443 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:27.344 Waiting 0.780 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:28.124 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:31.430 rake Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:32.436 Waiting 1.515 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:33.951 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
4:34.956 Waiting 1.184 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:36.140 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:36.140 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:37.146 shred Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:38.151 healing_touch Fluffy_Pillow 57.4/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:39.051 savage_roar Fluffy_Pillow 67.5/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
4:40.056 shadowmeld Fluffy_Pillow 53.7/100: 54% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
4:40.056 rake Fluffy_Pillow 53.7/100: 54% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
4:40.056 auto_attack Fluffy_Pillow 18.7/100: 19% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:41.060 Waiting 1.000 sec 29.9/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:42.060 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:43.065 Waiting 1.643 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:44.708 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:45.714 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:46.615 Waiting 0.782 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:47.397 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:48.401 Waiting 2.585 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:50.986 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:54.288 rake Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:55.293 Waiting 1.016 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:56.309 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
4:57.313 Waiting 0.400 sec 36.2/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:57.713 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:58.718 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:00.896 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
5:01.901 Waiting 1.231 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:04.407 savage_roar Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons
5:05.411 lunar_inspiration Fluffy_Pillow 11.5/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:06.416 tigers_fury Fluffy_Pillow 22.7/100: 23% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
5:06.416 use_item_ravaged_seed_pod Fluffy_Pillow 82.7/100: 83% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
5:06.416 shred Fluffy_Pillow 82.7/100: 83% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:07.420 shred Fluffy_Pillow 68.9/100: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:08.424 shred Fluffy_Pillow 55.1/100: 55% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:09.428 healing_touch Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:10.330 rip Fluffy_Pillow 51.4/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:11.334 rake Fluffy_Pillow 62.6/100: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:12.338 shred Fluffy_Pillow 38.8/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:13.342 shred Fluffy_Pillow 50.0/100: 50% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:14.348 healing_touch Fluffy_Pillow 21.2/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
5:15.249 Waiting 5.200 sec 31.3/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, leeching_pestilence
5:20.449 rip Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:21.453 ashamanes_frenzy Fluffy_Pillow 70.5/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:22.459 lunar_inspiration Fluffy_Pillow 81.7/100: 82% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:23.464 healing_touch Fluffy_Pillow 62.9/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:24.365 savage_roar Fluffy_Pillow 73.0/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:25.370 rake Fluffy_Pillow 44.2/100: 44% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:26.375 Waiting 1.812 sec 20.4/100: 20% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:28.187 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:29.192 Waiting 2.580 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:31.772 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:32.776 Waiting 1.182 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:33.958 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:34.963 healing_touch Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:35.863 rip Fluffy_Pillow 46.2/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:36.869 tigers_fury Fluffy_Pillow 27.5/100: 27% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:36.869 rake Fluffy_Pillow 87.5/100: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:37.874 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:38.878 shred Fluffy_Pillow 86.2/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:39.882 healing_touch Fluffy_Pillow 72.4/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:40.783 Waiting 0.600 sec 82.5/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
5:41.383 rip Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
5:42.387 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:43.390 shred Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:44.393 Waiting 0.652 sec 17.7/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:45.045 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
5:46.049 Waiting 0.300 sec 36.2/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:46.349 lunar_inspiration Fluffy_Pillow 39.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:47.353 healing_touch Fluffy_Pillow 20.7/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:48.253 Waiting 1.200 sec 30.8/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
5:49.453 savage_roar Fluffy_Pillow 44.2/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
5:50.458 rake Fluffy_Pillow 55.4/100: 55% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:51.463 Waiting 0.800 sec 31.6/100: 32% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:52.263 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:53.267 Waiting 2.590 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:55.857 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:56.861 shred Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:57.865 healing_touch Fluffy_Pillow 23.0/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:58.766 Waiting 0.600 sec 33.1/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:59.366 ferocious_bite Fluffy_Pillow 39.8/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:02.667 rake Fluffy_Pillow 36.8/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:03.673 Waiting 1.571 sec 13.0/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:05.244 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:06.248 Waiting 1.185 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:07.433 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:07.433 berserk Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:07.433 use_item_ravaged_seed_pod Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
6:07.433 potion Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
6:07.433 shred Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:08.438 shred Fluffy_Pillow 91.2/150: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:09.443 healing_touch Fluffy_Pillow 97.4/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:10.343 savage_roar Fluffy_Pillow 107.5/150: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:11.347 rake Fluffy_Pillow 113.7/150: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:12.350 shred Fluffy_Pillow 107.3/150: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:13.353 shred Fluffy_Pillow 98.5/150: 66% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:14.357 shred Fluffy_Pillow 89.7/150: 60% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:15.360 healing_touch Fluffy_Pillow 80.9/150: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:16.260 ferocious_bite Fluffy_Pillow 91.0/150: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:17.265 rake Fluffy_Pillow 89.7/150: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:18.270 lunar_inspiration Fluffy_Pillow 100.9/150: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:19.275 shred Fluffy_Pillow 97.1/150: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:20.281 shred Fluffy_Pillow 88.3/150: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:21.285 healing_touch Fluffy_Pillow 79.5/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:22.186 ferocious_bite Fluffy_Pillow 89.6/150: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
6:23.191 shred Fluffy_Pillow 75.8/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:24.195 shred Fluffy_Pillow 87.0/100: 87% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:25.199 shred Fluffy_Pillow 98.2/100: 98% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:26.203 healing_touch Fluffy_Pillow 69.4/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:27.103 Waiting 0.900 sec 79.4/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:28.003 ferocious_bite Fluffy_Pillow 89.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:29.007 rake Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:30.012 Waiting 0.300 sec 26.9/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:30.312 lunar_inspiration Fluffy_Pillow 30.2/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:31.315 Waiting 1.217 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:32.532 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
6:33.537 Waiting 0.400 sec 36.2/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:33.937 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
6:34.942 Waiting 1.676 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
6:36.618 shred Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages
6:37.620 healing_touch Fluffy_Pillow 41.7/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages
6:38.521 savage_roar Fluffy_Pillow 51.8/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
6:39.528 tigers_fury Fluffy_Pillow 23.0/100: 23% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages
6:39.528 ashamanes_frenzy Fluffy_Pillow 83.0/100: 83% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
6:40.534 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
6:40.534 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
6:40.534 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
6:41.540 shred Fluffy_Pillow 91.2/100: 91% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
6:42.546 healing_touch Fluffy_Pillow 77.4/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
6:43.446 Waiting 0.200 sec 87.5/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, horrific_appendages
6:43.646 ferocious_bite Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, horrific_appendages
6:44.649 lunar_inspiration Fluffy_Pillow 50.9/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
6:45.653 Waiting 0.800 sec 32.1/100: 32% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
6:46.453 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
6:47.457 Waiting 2.544 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
6:50.001 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:51.006 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:51.906 Waiting 2.081 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:53.987 savage_roar Fluffy_Pillow 45.1/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:56.017 rake Fluffy_Pillow 27.7/100: 28% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
6:57.022 Waiting 0.100 sec 38.9/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
6:57.122 lunar_inspiration Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
6:58.127 Waiting 1.035 sec 21.3/100: 21% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
6:59.417 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
7:00.422 Waiting 1.277 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:01.699 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:02.703 Waiting 2.637 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:05.340 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:06.345 Waiting 2.580 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:08.925 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:09.930 tigers_fury Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
7:09.930 use_item_ravaged_seed_pod Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
7:09.930 shred Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
7:10.934 shred Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
7:11.938 healing_touch Fluffy_Pillow 44.2/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
7:12.838 Waiting 1.800 sec 54.3/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
7:14.638 ferocious_bite Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
7:15.645 rake Fluffy_Pillow 75.6/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
7:16.650 lunar_inspiration Fluffy_Pillow 51.8/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
7:17.654 Waiting 0.700 sec 33.0/100: 33% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, leeching_pestilence
7:18.354 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, leeching_pestilence
7:19.358 Waiting 2.565 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, leeching_pestilence
7:21.923 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:22.928 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:23.828 Waiting 0.281 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
7:24.109 savage_roar Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
7:25.114 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:26.120 Waiting 2.526 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:28.646 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:29.651 Waiting 1.181 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 33.77% 33.77% 6220
Haste 11.56% 11.56% 3756
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 21649 19943 0
Mastery 57.32% 55.18% 6857
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 847.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Spontaneous Appendages
ilevel: 865, stats: { +986 Mastery }
Local Trinket2 Ravaged Seed Pod
ilevel: 865, stats: { +986 Haste }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="appendages_865 / pod_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=spontaneous_appendages,id=139325,bonus_id=1805
trinket2=ravaged_seed_pod,id=139320,bonus_id=1805
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=846.88
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=6220
# gear_haste_rating=2504
# gear_mastery_rating=6857
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

arcanocrystal_860 / appendages_865 : 323378 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
323377.7 323377.7 405.1 / 0.125% 40882.5 / 12.6% 21843.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.8 14.8 Energy 30.78% 43.0 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcanocrystal_860 / appendages_865 323378
Ashamane's Frenzy 15355 4.7% 6.1 78.64sec 1130918 1125839 Direct 91.4 10329 20645 14074 36.3%  
Periodic 30.2 136607 273175 186056 36.2% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.11 91.39 121.60 30.22 1.0045 0.6473 6908150.64 7512739.54 8.05 81417.95 1125839.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.21 63.70% 10328.89 7703 12245 10330.36 9342 11487 601267 883920 31.98
crit 33.17 36.30% 20644.53 15406 24490 20650.17 17927 22687 684833 1006770 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.3 63.79% 136606.61 84931 168764 136625.45 119316 154061 2633316 2633316 0.00
crit 10.9 36.21% 273175.49 174110 337528 273143.99 235184 315166 2988735 2988735 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 38128 11.8% 18.4 22.90sec 929712 0 Periodic 145.6 86506 173124 117771 36.1% 41.7%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.45 0.00 145.64 145.64 0.0000 1.2889 17152242.72 17152242.72 0.00 91371.91 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.1 63.90% 86506.31 60 102225 86415.24 76801 93589 8050983 8050983 0.00
crit 52.6 36.10% 173123.74 120 204450 172957.03 143592 189796 9101260 9101260 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 28698 8.9% 510.4 0.88sec 25297 28768 Direct 510.4 18588 37184 25298 36.1%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 510.39 510.39 0.00 0.00 0.8793 0.0000 12911649.00 18981347.05 31.98 28768.44 28768.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 326.24 63.92% 18587.79 14488 20826 18587.22 18210 18872 6064072 8914760 31.98
crit 184.15 36.08% 37183.86 28976 41653 37182.38 36240 37993 6847577 10066587 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6666 2.1% 10.7 43.97sec 280354 279104 Direct 10.7 194909 429363 280348 36.5%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.70 10.70 0.00 0.00 1.0045 0.0000 2998971.09 4408771.58 31.98 279103.87 279103.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.80 63.55% 194909.46 15191 256019 194421.42 37066 247671 1324819 1947609 31.98
crit 3.90 36.45% 429362.96 33508 565803 424359.53 0 565803 1674152 2461163 31.67
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Horrific Slam 7325 2.3% 100.7 3.51sec 32744 0 Direct 100.7 24065 48125 32744 36.1%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.68 100.68 0.00 0.00 0.0000 0.0000 3296652.87 3296652.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.36 63.92% 24065.00 18732 26928 24063.51 21802 25734 1548761 1548761 0.00
crit 36.32 36.08% 48124.72 37465 53856 48118.84 43319 51774 1747892 1747892 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16532.30
  • base_dd_max:18272.54
 
Moonfire (lunar_inspiration) 22925 7.1% 31.6 14.35sec 326602 325146 Direct 31.6 33634 67348 45710 35.8%  
Periodic 251.9 25886 51743 35220 36.1% 96.8%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.58 31.58 251.87 251.87 1.0045 1.7292 10314286.62 10314286.62 0.00 22073.98 325146.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.27 64.19% 33634.38 26218 37689 33631.60 31790 35538 681784 681784 0.00
crit 11.31 35.81% 67347.63 52436 75377 67342.43 59777 73739 761710 761710 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 161.0 63.90% 25886.27 158 29314 25886.12 25069 26506 4166607 4166607 0.00
crit 90.9 36.10% 51743.13 316 58627 51738.28 48574 53629 4704186 4704186 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2243 0.7% 24.3 18.26sec 41521 0 Periodic 71.9 14043 0 14043 0.0% 7.9%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.31 0.00 71.87 71.87 0.0000 0.4971 1009211.67 1483636.75 31.98 28247.87 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.9 100.00% 14042.82 27 15789 14045.19 13105 14928 1009212 1483637 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11525 3.5% 23.6 17.30sec 217390 0 Direct 23.6 159751 319433 217391 36.1%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.56 23.56 0.00 0.00 0.0000 0.0000 5120637.51 7527822.18 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.05 63.90% 159750.71 124406 178834 159745.80 143546 171657 2404516 3534866 31.98
crit 8.50 36.10% 319432.94 248812 357668 319273.81 269547 357668 2716122 3992956 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 73006 22.6% 47.3 9.54sec 694841 691735 Direct 47.3 88725 177288 120658 36.0%  
Periodic 223.6 89304 178610 121427 36.0% 94.9%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.28 47.28 223.58 223.58 1.0045 1.9095 32851877.50 32851877.50 0.00 69246.98 691734.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.24 63.96% 88725.39 41647 198614 88726.87 75001 102046 2682797 2682797 0.00
crit 17.04 36.04% 177288.32 83295 397228 177327.91 141581 249628 3021296 3021296 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.2 64.03% 89303.54 39 198614 89314.95 76937 98479 12783357 12783357 0.00
crit 80.4 35.97% 178609.73 78 397228 178666.06 154835 206974 14364428 14364428 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 87830 27.2% 22.9 15.46sec 1726232 1718517 Periodic 326.7 88953 177873 121047 36.1% 96.1%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.91 0.00 326.65 326.65 1.0045 1.3247 39539629.28 39539629.28 0.00 86763.37 1718516.57
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 208.8 63.91% 88953.12 69 102225 88938.22 81794 92677 18569712 18569712 0.00
crit 117.9 36.09% 177872.86 138 204450 177853.26 160457 188056 20969918 20969918 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 29678 9.2% 108.5 4.14sec 123008 122458 Direct 108.5 90387 180702 123011 36.1%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.45 108.45 0.00 0.00 1.0045 0.0000 13340412.35 19611669.79 31.98 122457.64 122457.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.28 63.88% 90386.58 63161 136190 90403.10 83866 95907 6261908 9205598 31.98
crit 39.17 36.12% 180701.81 126321 272380 180616.73 165210 199604 7078504 10406072 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
arcanocrystal_860 / appendages_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / appendages_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 181.89sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / appendages_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / appendages_865
  • harmful:false
  • if_expr:
 
Healing Touch 50.5 9.01sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.53 0.00 0.00 0.00 0.8723 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.6 24.65sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.63 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.29sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.32sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.12% 10.19% 45.5(45.5) 15.1

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 181.9sec 181.9sec 9.79% 14.94% 0.0(0.0) 2.9

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 50.5 0.0 9.0sec 9.0sec 46.21% 46.24% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.90%
  • bloodtalons_2:27.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 43.3 1.4 10.2sec 9.9sec 6.37% 15.19% 1.4(1.4) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.37%

Trigger Attempt Success

  • trigger_pct:8.75%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Horrific Appendages 5.7 1.0 72.0sec 59.6sec 16.99% 17.08% 101.7(101.7) 5.6

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:16.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Jacin's Ruse 6.6 1.8 64.0sec 48.7sec 24.56% 24.64% 1.8(1.8) 6.4

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.4sec 0.0sec 10.81% 10.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 50.2 1.2 8.9sec 8.7sec 74.29% 74.30% 1.2(1.2) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.29%

Trigger Attempt Success

  • trigger_pct:98.50%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.1 10.6 48.7sec 24.6sec 93.53% 93.22% 202.1(202.1) 7.1

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.3sec 133.3sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.83% 29.13% 0.0(0.0) 15.0

Buff details

  • buff initial source:arcanocrystal_860 / appendages_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
arcanocrystal_860 / appendages_865
ferocious_bite Energy 21.4 360.9 16.9 33.7 8309.6
ferocious_bite Combo Points 10.7 49.6 4.6 4.6 60503.2
lunar_inspiration Energy 31.6 782.9 24.8 24.8 13175.0
rake Energy 47.3 1346.5 28.5 28.5 24397.6
rip Energy 22.9 465.9 20.3 20.3 84865.1
rip Combo Points 22.9 114.5 5.0 5.0 345238.7
savage_roar Energy 18.6 479.4 25.7 25.7 0.0
savage_roar Combo Points 18.6 93.2 5.0 5.0 0.0
shred Energy 108.4 3222.7 29.7 29.7 4139.5
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.28 47.28 (18.16%) 1.00 0.00 0.00%
tigers_fury Energy 15.22 912.74 (11.28%) 59.96 0.55 0.06%
ashamanes_frenzy Combo Points 6.11 18.32 (7.04%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.58 31.58 (12.13%) 1.00 0.00 0.00%
shred Combo Points 108.45 108.45 (41.65%) 1.00 0.00 0.00%
energy_regen Energy 2085.34 5041.83 (62.30%) 2.42 71.87 1.41%
clearcasting Energy 43.22 1475.60 (18.23%) 34.14 0.00 0.00%
ashamanes_energy Energy 45.47 662.58 (8.19%) 14.57 19.41 2.85%
primal_fury Combo Points 67.53 54.77 (21.03%) 0.81 12.76 18.89%
Resource RPS-Gain RPS-Loss
Energy 14.70 14.79
Combo Points 0.58 0.57
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 35.76 0.00 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.08 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
clearcasting 44.7 9.9sec
clearcasting_wasted 1.4 122.1sec
primal_fury 67.5 6.6sec

Statistics & Data Analysis

Fight Length
Sample Data arcanocrystal_860 / appendages_865 Fight Length
Count 2499
Mean 450.05
Minimum 360.07
Maximum 539.96
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data arcanocrystal_860 / appendages_865 Damage Per Second
Count 2499
Mean 323377.68
Minimum 288324.69
Maximum 358549.11
Spread ( max - min ) 70224.43
Range [ ( max - min ) / 2 * 100% ] 10.86%
Standard Deviation 10332.0934
5th Percentile 306495.47
95th Percentile 340376.19
( 95th Percentile - 5th Percentile ) 33880.73
Mean Distribution
Standard Deviation 206.6832
95.00% Confidence Intervall ( 322972.59 - 323782.77 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3921
0.1 Scale Factor Error with Delta=300 911297
0.05 Scale Factor Error with Delta=300 3645191
0.01 Scale Factor Error with Delta=300 91129777
Priority Target DPS
Sample Data arcanocrystal_860 / appendages_865 Priority Target Damage Per Second
Count 2499
Mean 323377.68
Minimum 288324.69
Maximum 358549.11
Spread ( max - min ) 70224.43
Range [ ( max - min ) / 2 * 100% ] 10.86%
Standard Deviation 10332.0934
5th Percentile 306495.47
95th Percentile 340376.19
( 95th Percentile - 5th Percentile ) 33880.73
Mean Distribution
Standard Deviation 206.6832
95.00% Confidence Intervall ( 322972.59 - 323782.77 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3921
0.1 Scale Factor Error with Delta=300 911297
0.05 Scale Factor Error with Delta=300 3645191
0.01 Scale Factor Error with Delta=300 91129777
DPS(e)
Sample Data arcanocrystal_860 / appendages_865 Damage Per Second (Effective)
Count 2499
Mean 323377.68
Minimum 288324.69
Maximum 358549.11
Spread ( max - min ) 70224.43
Range [ ( max - min ) / 2 * 100% ] 10.86%
Damage
Sample Data arcanocrystal_860 / appendages_865 Damage
Count 2499
Mean 145443721.25
Minimum 107978166.10
Maximum 187854961.88
Spread ( max - min ) 79876795.78
Range [ ( max - min ) / 2 * 100% ] 27.46%
DTPS
Sample Data arcanocrystal_860 / appendages_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data arcanocrystal_860 / appendages_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data arcanocrystal_860 / appendages_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data arcanocrystal_860 / appendages_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data arcanocrystal_860 / appendages_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data arcanocrystal_860 / appendages_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data arcanocrystal_860 / appendages_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data arcanocrystal_860 / appendages_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.57 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.57 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.22 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 3.94 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 49.53 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.07 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.91 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 10.57 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 6.76 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.11 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.57 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.72 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.58 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 108.45 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQCAIQEMJQQQOPELOQQQEJQQQQEKOPQECJN89QQQQEKPQOQEJOPQELOCQQQEJOPQQEIMOPEJOQCQEJOPQEIOQPQEJOQQCQPEJOQQEIOPOEJQQCPQEJMOQEIOQQPEJOQQQEKOPCAN89EJQQQQELQQPQELOQQQQEIOPCQEJOQQPQEJOQEMIOPQQECJOQQQEJOPQEIOQPEJCOQQEJOPQQEIOQPQEJCN89QQQPEJOQEOPQIQCQOQEJMPQEKOQQQEDOPQELCABOQQEKOPQELQQQQELOPQELOQQQECKOPQQEDOPQQEKMODCPQQQELOQPQEKO

Sample Sequence Table

time name target resources buffs
Pre flask arcanocrystal_860 / appendages_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food arcanocrystal_860 / appendages_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation arcanocrystal_860 / appendages_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.006 lunar_inspiration Fluffy_Pillow 76.5/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 60.9/100: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:03.014 tigers_fury Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, potion_of_the_old_war
0:03.014 berserk Fluffy_Pillow 95.4/100: 95% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:03.014 savage_roar Fluffy_Pillow 95.4/150: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:04.018 shred Fluffy_Pillow 104.8/150: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:05.025 healing_touch Fluffy_Pillow 114.3/150: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:05.780 ashamanes_frenzy Fluffy_Pillow 125.2/150: 83% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:06.785 rip Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons, berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:07.790 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:08.794 shred Fluffy_Pillow 144.5/150: 96% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:09.798 shred Fluffy_Pillow 138.9/150: 93% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:10.801 rake Fluffy_Pillow 133.3/150: 89% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:11.805 lunar_inspiration Fluffy_Pillow 130.3/150: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:12.807 healing_touch Fluffy_Pillow 129.7/150: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:13.563 ferocious_bite Fluffy_Pillow 140.6/150: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
0:14.569 rake Fluffy_Pillow 142.6/150: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:15.575 shred Fluffy_Pillow 139.6/150: 93% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.579 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.584 shred Fluffy_Pillow 144.5/150: 96% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.589 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:19.342 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, potion_of_the_old_war
0:20.347 shred Fluffy_Pillow 84.5/100: 84% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
0:21.351 shred Fluffy_Pillow 58.9/100: 59% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.355 Waiting 0.500 sec 33.4/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.855 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.860 Waiting 0.792 sec 15.0/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.652 shred Fluffy_Pillow 26.4/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:25.656 healing_touch Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:26.409 savage_roar Fluffy_Pillow 51.7/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:28.177 rake Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:29.181 Waiting 0.981 sec 16.6/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:30.162 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, bloodtalons, predatory_swiftness, savage_roar
0:31.167 shred Fluffy_Pillow 45.2/100: 45% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:32.171 healing_touch Fluffy_Pillow 19.7/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:32.926 tigers_fury Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, jacins_ruse
0:33.014 rip Fluffy_Pillow 91.8/100: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
0:34.016 shadowmeld Fluffy_Pillow 91.2/100: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:34.016 rake Fluffy_Pillow 91.2/100: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:34.016 auto_attack Fluffy_Pillow 56.2/100: 56% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:35.021 shred Fluffy_Pillow 85.7/100: 86% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:36.026 shred Fluffy_Pillow 75.2/100: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:37.030 shred Fluffy_Pillow 49.6/100: 50% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:38.035 shred Fluffy_Pillow 24.1/100: 24% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:39.040 healing_touch Fluffy_Pillow 38.6/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:39.795 Waiting 3.300 sec 49.4/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
0:43.095 savage_roar Fluffy_Pillow 90.0/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
0:44.100 lunar_inspiration Fluffy_Pillow 61.1/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
0:45.105 shred Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
0:46.111 Waiting 1.052 sec 13.3/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:47.419 rake Fluffy_Pillow 27.8/100: 28% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
0:48.425 Waiting 0.100 sec 39.0/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:48.525 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:49.529 healing_touch Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:50.437 Waiting 3.038 sec 21.3/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:53.475 rip Fluffy_Pillow 54.9/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:54.481 rake Fluffy_Pillow 66.0/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
0:55.485 lunar_inspiration Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
0:56.488 shred Fluffy_Pillow 53.3/100: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
0:57.492 healing_touch Fluffy_Pillow 64.4/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:58.400 Waiting 1.400 sec 74.4/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
0:59.800 ferocious_bite Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:00.806 rake Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:01.812 Waiting 1.000 sec 27.2/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:02.812 tigers_fury Fluffy_Pillow 38.3/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:03.014 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:04.019 shred Fluffy_Pillow 86.1/100: 86% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:05.023 shred Fluffy_Pillow 72.2/100: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:06.027 healing_touch Fluffy_Pillow 58.4/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:06.937 Waiting 1.900 sec 68.4/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
1:08.837 rip Fluffy_Pillow 89.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
1:09.841 rake Fluffy_Pillow 70.6/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:10.846 lunar_inspiration Fluffy_Pillow 46.7/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:11.851 Waiting 1.100 sec 27.9/100: 28% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:12.951 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:13.955 Waiting 2.650 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:16.605 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:17.609 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
1:20.305 savage_roar Fluffy_Pillow 41.5/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
1:21.309 ashamanes_frenzy Fluffy_Pillow 12.6/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:22.567 rake Fluffy_Pillow 26.5/100: 27% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
1:23.573 lunar_inspiration Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:24.577 healing_touch Fluffy_Pillow 18.8/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:25.484 Waiting 0.600 sec 28.8/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:26.084 rip Fluffy_Pillow 35.5/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:28.879 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:29.883 Waiting 2.526 sec 12.5/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:32.409 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:33.413 tigers_fury Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:33.413 shred Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:34.417 healing_touch Fluffy_Pillow 57.7/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.324 Waiting 0.600 sec 67.8/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:35.924 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:36.928 rake Fluffy_Pillow 85.5/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:37.934 lunar_inspiration Fluffy_Pillow 61.7/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:38.938 shred Fluffy_Pillow 42.8/100: 43% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:39.942 healing_touch Fluffy_Pillow 13.9/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:40.851 Waiting 3.500 sec 24.0/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:44.351 savage_roar Fluffy_Pillow 62.7/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
1:45.613 rake Fluffy_Pillow 36.7/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:46.619 Waiting 2.497 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:49.116 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:50.121 lunar_inspiration Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
1:51.126 shred Fluffy_Pillow 22.8/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
1:52.130 healing_touch Fluffy_Pillow 33.9/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:53.038 Waiting 3.800 sec 43.9/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:56.838 rip Fluffy_Pillow 86.0/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:57.843 rake Fluffy_Pillow 67.1/100: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:58.848 shred Fluffy_Pillow 43.3/100: 43% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:59.852 Waiting 2.359 sec 14.4/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:02.211 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:03.214 tigers_fury Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:03.413 shred Fluffy_Pillow 73.8/100: 74% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:04.417 lunar_inspiration Fluffy_Pillow 59.9/100: 60% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:05.423 healing_touch Fluffy_Pillow 56.1/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:06.331 Waiting 0.800 sec 66.1/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:07.131 rip Fluffy_Pillow 90.0/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:08.136 rake Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:09.139 shred Fluffy_Pillow 47.2/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury
2:10.142 Waiting 2.002 sec 18.3/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
2:12.144 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
2:13.148 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
2:15.844 savage_roar Fluffy_Pillow 41.5/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
2:18.900 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:19.903 Waiting 1.727 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:21.630 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:23.911 rake Fluffy_Pillow 25.8/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
2:24.915 healing_touch Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:25.823 Waiting 2.300 sec 47.0/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:28.123 rip Fluffy_Pillow 72.4/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:29.126 shred Fluffy_Pillow 53.5/100: 54% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:30.130 Waiting 1.400 sec 24.7/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:31.530 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:32.533 Waiting 1.240 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:33.773 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:33.773 lunar_inspiration Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
2:34.776 shred Fluffy_Pillow 81.1/100: 81% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
2:35.782 healing_touch Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
2:36.690 rip Fluffy_Pillow 77.3/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, horrific_appendages
2:37.695 ashamanes_frenzy Fluffy_Pillow 73.4/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
2:38.700 rake Fluffy_Pillow 84.6/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
2:39.705 shred Fluffy_Pillow 60.7/100: 61% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
2:40.710 healing_touch Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, horrific_appendages
2:41.618 savage_roar Fluffy_Pillow 81.9/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, horrific_appendages
2:42.623 rake Fluffy_Pillow 53.0/100: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
2:43.626 shred Fluffy_Pillow 64.1/100: 64% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:44.631 Waiting 0.500 sec 35.2/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:45.131 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:46.135 Waiting 1.684 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:47.819 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:48.824 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:49.731 Waiting 0.897 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:50.628 rip Fluffy_Pillow 31.6/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:51.633 rake Fluffy_Pillow 42.8/100: 43% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:52.639 Waiting 1.050 sec 18.9/100: 19% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:53.689 shred Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
2:54.694 shred Fluffy_Pillow 41.7/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:55.699 Waiting 1.602 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:57.301 shred Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
2:58.305 healing_touch Fluffy_Pillow 41.6/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:59.213 Waiting 1.600 sec 51.7/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:00.813 savage_roar Fluffy_Pillow 69.4/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:01.820 rake Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
3:02.827 lunar_inspiration Fluffy_Pillow 51.7/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:03.834 tigers_fury Fluffy_Pillow 32.9/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:03.834 berserk Fluffy_Pillow 92.9/100: 93% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:03.834 shadowmeld Fluffy_Pillow 92.9/150: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:03.834 rake Fluffy_Pillow 92.9/150: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points shadowmeld, clearcasting, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:03.834 auto_attack Fluffy_Pillow 92.9/150: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:04.840 healing_touch Fluffy_Pillow 119.0/150: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:05.750 rip Fluffy_Pillow 129.1/150: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, jacins_ruse
3:06.756 shred Fluffy_Pillow 140.2/150: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:07.761 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:08.765 shred Fluffy_Pillow 141.1/150: 94% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:09.769 shred Fluffy_Pillow 132.2/150: 88% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:10.773 healing_touch Fluffy_Pillow 123.4/150: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:11.681 ferocious_bite Fluffy_Pillow 133.4/150: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury
3:12.684 shred Fluffy_Pillow 119.5/150: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:13.688 shred Fluffy_Pillow 110.6/150: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar
3:14.693 lunar_inspiration Fluffy_Pillow 101.8/150: 68% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar
3:15.699 shred Fluffy_Pillow 97.9/150: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar
3:16.705 healing_touch Fluffy_Pillow 89.0/150: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:17.614 ferocious_bite Fluffy_Pillow 99.1/150: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:18.619 rake Fluffy_Pillow 85.2/150: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:19.624 shred Fluffy_Pillow 78.9/100: 79% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:20.628 shred Fluffy_Pillow 50.0/100: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:21.634 Waiting 1.750 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:23.384 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:24.389 Waiting 2.607 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:26.996 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:28.003 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:28.910 Waiting 0.799 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:30.221 savage_roar Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
3:31.226 rake Fluffy_Pillow 47.3/100: 47% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:32.231 Waiting 0.638 sec 23.5/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:32.869 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:33.873 tigers_fury Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
3:33.873 shred Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:34.876 healing_touch Fluffy_Pillow 57.8/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:35.786 rip Fluffy_Pillow 67.8/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
3:36.790 rake Fluffy_Pillow 63.9/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:37.795 shred Fluffy_Pillow 55.1/100: 55% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
3:38.798 Waiting 1.300 sec 26.2/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
3:40.098 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
3:41.102 Waiting 1.701 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
3:42.803 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:43.807 shred Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
3:44.810 healing_touch Fluffy_Pillow 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:45.717 Waiting 2.700 sec 32.8/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:48.417 rip Fluffy_Pillow 62.7/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:49.423 rake Fluffy_Pillow 43.8/100: 44% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:50.429 shred Fluffy_Pillow 20.0/100: 20% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
3:51.434 Waiting 0.400 sec 31.1/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:51.834 healing_touch Fluffy_Pillow 35.5/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:52.742 ashamanes_frenzy Fluffy_Pillow 45.6/100: 46% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:53.747 Waiting 0.500 sec 56.7/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, jacins_ruse
3:54.247 savage_roar Fluffy_Pillow 62.3/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, jacins_ruse
3:55.505 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:56.510 Waiting 1.646 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:58.156 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:59.160 shred Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
4:00.165 Waiting 1.600 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:01.765 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:02.769 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:03.676 tigers_fury Fluffy_Pillow 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:03.873 Waiting 0.500 sec 83.8/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:04.373 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:05.377 rake Fluffy_Pillow 85.5/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:06.383 shred Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:07.388 shred Fluffy_Pillow 62.8/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:08.392 Waiting 0.600 sec 33.9/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:08.992 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:09.997 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:10.905 Waiting 6.097 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:17.002 rip Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:18.009 rake Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:19.015 lunar_inspiration Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness
4:20.019 Waiting 1.200 sec 27.6/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:21.219 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:22.225 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:24.413 savage_roar Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
4:25.417 rake Fluffy_Pillow 47.4/100: 47% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:26.421 Waiting 1.533 sec 23.5/100: 24% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:27.954 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:28.960 Waiting 1.706 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:30.666 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:31.670 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:32.577 Waiting 0.799 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:33.376 rip Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:34.381 tigers_fury Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:34.381 rake Fluffy_Pillow 71.7/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:35.384 shred Fluffy_Pillow 62.8/100: 63% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:36.388 shred Fluffy_Pillow 48.9/100: 49% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:37.393 healing_touch Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:38.300 Waiting 4.000 sec 45.1/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:42.300 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
4:43.305 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:44.310 lunar_inspiration Fluffy_Pillow 76.1/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:45.315 shred Fluffy_Pillow 57.3/100: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:46.320 Waiting 1.100 sec 28.4/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:47.420 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:48.424 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:51.120 savage_roar Fluffy_Pillow 41.5/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
4:54.172 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:55.175 shred Fluffy_Pillow 11.4/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:56.179 Waiting 0.720 sec 22.6/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:56.899 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:57.903 Waiting 2.605 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:00.508 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:01.514 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:02.422 Waiting 0.799 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:03.221 rip Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:04.225 tigers_fury Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:04.381 shadowmeld Fluffy_Pillow 73.4/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:04.381 rake Fluffy_Pillow 73.4/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:04.381 auto_attack Fluffy_Pillow 38.4/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:05.384 shred Fluffy_Pillow 64.5/100: 64% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:06.389 shred Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:07.392 Waiting 0.300 sec 36.7/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:07.692 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:08.695 Waiting 2.150 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:10.845 lunar_inspiration Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:11.850 healing_touch Fluffy_Pillow 16.1/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:12.758 Waiting 2.300 sec 26.1/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:15.058 rip Fluffy_Pillow 51.6/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:16.063 Waiting 0.500 sec 32.7/100: 33% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
5:16.563 rake Fluffy_Pillow 38.3/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness
5:17.566 Waiting 2.359 sec 14.4/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness
5:19.925 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness
5:20.930 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
5:23.117 rake Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2)
5:24.122 Waiting 1.676 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons
5:25.798 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons
5:26.802 Waiting 1.205 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons
5:28.007 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons
5:29.522 savage_roar Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points
5:30.527 Waiting 2.492 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:33.019 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:34.024 Waiting 1.208 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:35.232 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:35.232 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:36.234 rake Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:37.239 shred Fluffy_Pillow 97.2/100: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:38.243 healing_touch Fluffy_Pillow 83.3/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:39.150 rip Fluffy_Pillow 93.4/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:40.154 ashamanes_frenzy Fluffy_Pillow 74.5/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:41.158 lunar_inspiration Fluffy_Pillow 85.6/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:42.163 shred Fluffy_Pillow 66.7/100: 67% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:43.167 healing_touch Fluffy_Pillow 77.9/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:44.074 Waiting 0.100 sec 87.9/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:44.174 savage_roar Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:45.178 rake Fluffy_Pillow 60.1/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:46.183 Waiting 0.400 sec 36.3/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:46.583 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:47.588 Waiting 1.190 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:48.778 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
5:49.784 Waiting 0.400 sec 36.1/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
5:50.184 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
5:51.188 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
5:52.095 Waiting 0.395 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
5:52.490 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
5:55.789 rake Fluffy_Pillow 36.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
5:56.794 Waiting 1.114 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:57.908 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages
5:58.912 Waiting 0.400 sec 36.1/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:59.312 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
6:00.315 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:01.222 Waiting 2.598 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:03.820 ferocious_bite Fluffy_Pillow 50.5/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:05.082 tigers_fury Fluffy_Pillow 14.4/100: 14% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:05.232 berserk Fluffy_Pillow 76.1/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:05.232 potion Fluffy_Pillow 76.1/150: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
6:05.232 rake Fluffy_Pillow 76.1/150: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:06.238 shred Fluffy_Pillow 84.7/150: 56% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:07.242 shred Fluffy_Pillow 90.9/150: 61% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:08.246 healing_touch Fluffy_Pillow 97.0/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:09.154 savage_roar Fluffy_Pillow 107.0/150: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:10.159 rake Fluffy_Pillow 118.2/150: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:11.163 lunar_inspiration Fluffy_Pillow 111.8/150: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:12.168 shred Fluffy_Pillow 107.9/150: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:13.172 healing_touch Fluffy_Pillow 119.0/150: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:14.080 ferocious_bite Fluffy_Pillow 129.1/150: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:15.085 shred Fluffy_Pillow 115.2/150: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:16.091 shred Fluffy_Pillow 106.3/150: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:17.095 shred Fluffy_Pillow 97.5/150: 65% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:18.098 shred Fluffy_Pillow 88.6/150: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:19.103 healing_touch Fluffy_Pillow 79.7/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:20.011 ferocious_bite Fluffy_Pillow 89.7/150: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:21.016 rake Fluffy_Pillow 75.9/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:22.022 lunar_inspiration Fluffy_Pillow 52.0/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:23.026 shred Fluffy_Pillow 33.1/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, potion_of_the_old_war
6:24.030 healing_touch Fluffy_Pillow 44.2/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:24.938 Waiting 3.200 sec 54.3/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, potion_of_the_old_war
6:28.138 ferocious_bite Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, potion_of_the_old_war
6:29.142 rake Fluffy_Pillow 75.9/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:30.148 shred Fluffy_Pillow 52.0/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, potion_of_the_old_war
6:31.150 shred Fluffy_Pillow 63.1/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:32.154 Waiting 0.600 sec 34.2/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:32.754 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:33.760 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:34.668 Waiting 0.366 sec 22.0/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:35.034 tigers_fury Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:35.232 Waiting 0.100 sec 88.3/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:35.332 savage_roar Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:36.337 rake Fluffy_Pillow 75.5/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:37.344 lunar_inspiration Fluffy_Pillow 66.7/100: 67% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:38.349 shred Fluffy_Pillow 62.8/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:39.354 Waiting 0.600 sec 33.9/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:39.954 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:40.957 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:41.865 Waiting 4.194 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
6:46.059 ferocious_bite Fluffy_Pillow 68.2/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:47.830 rake Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:48.835 Waiting 1.500 sec 13.9/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:50.335 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:51.338 Waiting 2.606 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:53.944 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:54.949 Waiting 1.408 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:56.357 shred Fluffy_Pillow 27.2/100: 27% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
6:57.361 healing_touch Fluffy_Pillow 38.3/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:58.269 savage_roar Fluffy_Pillow 48.4/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:59.273 ashamanes_frenzy Fluffy_Pillow 19.5/100: 20% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:00.788 rake Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
7:01.792 Waiting 1.238 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:03.030 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:04.033 Waiting 1.254 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:05.287 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:05.287 lunar_inspiration Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:06.291 shred Fluffy_Pillow 81.1/100: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:07.294 shred Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
7:08.298 shred Fluffy_Pillow 53.3/100: 53% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
7:09.303 healing_touch Fluffy_Pillow 24.5/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
7:10.211 Waiting 5.000 sec 34.5/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, horrific_appendages
7:15.211 ferocious_bite Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
7:16.216 rake Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
7:17.221 shred Fluffy_Pillow 52.1/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
7:18.224 Waiting 0.658 sec 23.2/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
7:18.882 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
7:19.888 Waiting 2.603 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:22.491 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:23.495 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:24.402 Waiting 1.701 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:26.103 savage_roar Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:29.404 rake Fluffy_Pillow 37.0/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 36.08% 36.08% 7027
Haste 10.73% 10.73% 3488
Damage / Heal Versatility 7.65% 7.65% 3058
Attack Power 21649 19943 0
Mastery 61.94% 59.80% 7664
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 847.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Trinket2 Spontaneous Appendages
ilevel: 865, stats: { +986 Mastery }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="arcanocrystal_860 / appendages_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=unstable_arcanocrystal,id=141482
trinket2=spontaneous_appendages,id=139325,bonus_id=1805
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=846.56
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=7027
# gear_haste_rating=2325
# gear_mastery_rating=7664
# gear_versatility_rating=3058
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

arcanocrystal_860 / call_865 : 321551 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
321550.7 321550.7 404.0 / 0.126% 39856.4 / 12.4% 21371.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.0 15.0 Energy 30.44% 43.6 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcanocrystal_860 / call_865 321551
Ashamane's Frenzy 15357 4.8% 6.1 78.36sec 1128329 1123421 Direct 91.6 10192 20397 14045 37.8%  
Periodic 30.3 134840 269761 185869 37.8% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.12 91.59 121.84 30.25 1.0045 0.6469 6909042.22 7513764.29 8.05 81309.63 1123421.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.01 62.24% 10191.76 7524 13052 10192.19 9249 11397 580978 854093 31.98
crit 34.58 37.76% 20397.44 15048 26104 20401.12 18486 23280 705405 1037012 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.8 62.18% 134840.47 82959 179884 134828.80 122645 151530 2536629 2536629 0.00
crit 11.4 37.82% 269761.29 165918 359768 269842.95 231576 309210 3086029 3086029 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 38913 12.1% 18.8 22.77sec 933270 0 Periodic 148.9 85470 170815 117673 37.7% 42.7%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.77 0.00 148.87 148.87 0.0000 1.2902 17517772.06 17517772.06 0.00 91201.35 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.7 62.27% 85469.97 39 108961 85378.08 74170 93272 7923255 7923255 0.00
crit 56.2 37.73% 170815.33 117 217921 170656.65 148269 189772 9594518 9594518 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 29811 9.3% 522.9 0.86sec 25647 29875 Direct 522.9 18612 37241 25647 37.8%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 522.94 522.94 0.00 0.00 0.8585 0.0000 13411911.01 19716779.59 31.98 29875.42 29875.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 325.46 62.24% 18612.25 14488 20826 18612.23 18294 18915 6057501 8905100 31.98
crit 197.48 37.76% 37240.76 28976 41653 37240.29 36334 37969 7354410 10811680 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 7354 2.3% 11.3 41.32sec 291154 289850 Direct 11.3 200113 441658 291160 37.7%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.35 11.35 0.00 0.00 1.0045 0.0000 3304286.07 4857613.51 31.98 289849.65 289849.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.07 62.30% 200113.38 15436 256019 199825.16 80844 256019 1414796 2079884 31.98
crit 4.28 37.70% 441658.36 34258 565803 438178.48 0 565803 1889490 2777729 31.77
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 23759 7.4% 31.6 14.33sec 338022 336507 Direct 31.6 33697 67353 46406 37.8%  
Periodic 257.7 25993 52002 35790 37.7% 96.9%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.62 31.62 257.68 257.68 1.0045 1.6928 10689822.25 10689822.25 0.00 22843.26 336507.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.68 62.24% 33696.95 26218 37689 33692.56 31524 35722 663308 663308 0.00
crit 11.94 37.76% 67353.32 52436 75377 67363.59 59459 72919 804238 804238 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 160.6 62.33% 25993.17 14 29314 25993.40 25029 26700 4174916 4174916 0.00
crit 97.1 37.67% 52002.11 29 58627 52000.13 49576 53657 5047360 5047360 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2306 0.7% 25.0 17.96sec 41544 0 Periodic 73.8 14060 0 14060 0.0% 8.1%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.96 0.00 73.76 73.76 0.0000 0.4970 1037125.62 1524672.90 31.98 28291.16 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.8 100.00% 14060.44 27 15789 14064.22 13151 15007 1037126 1524673 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 12077 3.7% 24.3 16.76sec 220450 0 Direct 24.3 159709 319888 220491 37.9%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.33 24.33 0.00 0.00 0.0000 0.0000 5364098.87 7885733.44 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.10 62.08% 159708.73 124406 178834 159679.82 148251 171058 2412345 3546375 31.98
crit 9.23 37.92% 319887.87 248812 357668 319911.30 264363 357668 2951754 4339358 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 73286 22.8% 47.5 9.49sec 693713 690610 Direct 47.5 87583 175014 120686 37.9%  
Periodic 223.6 88465 176703 121831 37.8% 95.1%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.54 47.54 223.60 223.60 1.0045 1.9145 32978696.74 32978696.74 0.00 69307.73 690609.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.54 62.13% 87582.86 40680 211701 87602.56 73585 99912 2586982 2586982 0.00
crit 18.00 37.87% 175013.92 81361 423403 174923.04 137515 222457 3150570 3150570 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 139.0 62.19% 88465.34 38 211701 88483.60 80068 97966 12301117 12301117 0.00
crit 84.5 37.81% 176703.09 84 423403 176758.99 151261 203655 14940028 14940028 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 88046 27.4% 23.1 15.31sec 1715925 1708297 Periodic 327.5 87852 175728 121047 37.8% 96.5%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.10 0.00 327.50 327.50 1.0045 1.3262 39642737.50 39642737.50 0.00 86641.89 1708296.88
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 203.8 62.23% 87852.46 64 108961 87839.45 82660 92710 17903889 17903889 0.00
crit 123.7 37.77% 175727.61 135 217921 175698.59 164010 185054 21738848 21738848 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 30642 9.5% 110.4 4.07sec 124814 124256 Direct 110.4 90574 181237 124814 37.8%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.36 110.36 0.00 0.00 1.0045 0.0000 13774726.72 20250153.05 31.98 124255.59 124255.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.68 62.24% 90574.36 63161 136190 90594.52 83253 96593 6220899 9145311 31.98
crit 41.68 37.76% 181237.39 126321 272380 181188.47 166849 195513 7553827 11104842 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
arcanocrystal_860 / call_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / call_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.04sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Cleansed Drake's Breath 4.3 78.86sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.25 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / call_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / call_865
  • harmful:false
  • if_expr:
 
Healing Touch 51.7 8.81sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 51.74 0.00 0.00 0.00 0.8543 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.8 24.41sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.78 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.03sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.34sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.19 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.10% 10.17% 45.4(45.4) 15.1

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.1sec 182.1sec 9.78% 14.72% 0.0(0.0) 2.9

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.25% 0.0(0.0) 1.0

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 51.7 0.0 8.8sec 8.8sec 46.75% 46.79% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.78%
  • bloodtalons_2:27.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Cleansed Ancient's Blessing 3.9 0.3 86.9sec 78.5sec 9.01% 9.11% 0.3(0.3) 3.8

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_ancients_blessing_1:9.01%

Trigger Attempt Success

  • trigger_pct:98.75%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 3.9 0.3 86.7sec 78.0sec 9.04% 9.14% 0.3(0.3) 3.9

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_sisters_blessing_1:9.04%

Trigger Attempt Success

  • trigger_pct:98.39%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 3.9 0.3 88.4sec 79.6sec 9.00% 9.10% 0.3(0.3) 3.8

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_wisps_blessing_1:9.00%

Trigger Attempt Success

  • trigger_pct:98.70%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Clearcasting 44.2 1.5 10.0sec 9.7sec 6.64% 15.29% 1.5(1.5) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.64%

Trigger Attempt Success

  • trigger_pct:8.73%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.9 64.3sec 48.4sec 24.47% 24.55% 1.9(1.9) 6.3

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.5sec 0.0sec 10.81% 10.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 51.4 1.1 8.7sec 8.5sec 74.06% 74.07% 1.1(1.1) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.06%

Trigger Attempt Success

  • trigger_pct:98.68%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 7.6 11.2 51.7sec 24.4sec 94.26% 93.95% 202.1(202.1) 6.6

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:94.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.1sec 133.1sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.78% 28.97% 0.0(0.0) 14.9

Buff details

  • buff initial source:arcanocrystal_860 / call_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
arcanocrystal_860 / call_865
ferocious_bite Energy 22.7 389.4 17.2 34.3 8486.3
ferocious_bite Combo Points 11.3 53.3 4.7 4.7 62023.2
lunar_inspiration Energy 31.6 784.7 24.8 24.8 13622.1
rake Energy 47.5 1354.3 28.5 28.5 24350.2
rip Energy 23.1 467.6 20.2 20.2 84778.8
rip Combo Points 23.1 115.5 5.0 5.0 343180.8
savage_roar Energy 18.8 482.8 25.7 25.7 0.0
savage_roar Combo Points 18.8 93.9 5.0 5.0 0.0
shred Energy 110.4 3288.7 29.8 29.8 4188.6
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.54 47.54 (17.87%) 1.00 0.00 0.00%
tigers_fury Energy 15.19 911.12 (11.07%) 59.97 0.51 0.06%
ashamanes_frenzy Combo Points 6.12 18.37 (6.91%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.62 31.62 (11.89%) 1.00 0.00 0.00%
shred Combo Points 110.37 110.37 (41.50%) 1.00 0.00 0.00%
energy_regen Energy 2025.76 5158.14 (62.64%) 2.55 78.41 1.50%
clearcasting Energy 44.10 1503.62 (18.26%) 34.10 0.00 0.00%
ashamanes_energy Energy 45.40 661.24 (8.03%) 14.57 19.69 2.89%
primal_fury Combo Points 71.62 58.06 (21.83%) 0.81 13.57 18.94%
Resource RPS-Gain RPS-Loss
Energy 14.96 15.04
Combo Points 0.59 0.58
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 38.29 0.13 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.14 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.9%

Procs

Count Interval
clearcasting 45.7 9.7sec
clearcasting_wasted 1.5 119.2sec
primal_fury 71.6 6.3sec

Statistics & Data Analysis

Fight Length
Sample Data arcanocrystal_860 / call_865 Fight Length
Count 2499
Mean 450.05
Minimum 360.07
Maximum 539.96
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data arcanocrystal_860 / call_865 Damage Per Second
Count 2499
Mean 321550.72
Minimum 287419.29
Maximum 360988.35
Spread ( max - min ) 73569.06
Range [ ( max - min ) / 2 * 100% ] 11.44%
Standard Deviation 10304.4721
5th Percentile 304910.56
95th Percentile 339018.03
( 95th Percentile - 5th Percentile ) 34107.47
Mean Distribution
Standard Deviation 206.1307
95.00% Confidence Intervall ( 321146.71 - 321954.73 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3945
0.1 Scale Factor Error with Delta=300 906431
0.05 Scale Factor Error with Delta=300 3625727
0.01 Scale Factor Error with Delta=300 90643186
Priority Target DPS
Sample Data arcanocrystal_860 / call_865 Priority Target Damage Per Second
Count 2499
Mean 321550.72
Minimum 287419.29
Maximum 360988.35
Spread ( max - min ) 73569.06
Range [ ( max - min ) / 2 * 100% ] 11.44%
Standard Deviation 10304.4721
5th Percentile 304910.56
95th Percentile 339018.03
( 95th Percentile - 5th Percentile ) 34107.47
Mean Distribution
Standard Deviation 206.1307
95.00% Confidence Intervall ( 321146.71 - 321954.73 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3945
0.1 Scale Factor Error with Delta=300 906431
0.05 Scale Factor Error with Delta=300 3625727
0.01 Scale Factor Error with Delta=300 90643186
DPS(e)
Sample Data arcanocrystal_860 / call_865 Damage Per Second (Effective)
Count 2499
Mean 321550.72
Minimum 287419.29
Maximum 360988.35
Spread ( max - min ) 73569.06
Range [ ( max - min ) / 2 * 100% ] 11.44%
Damage
Sample Data arcanocrystal_860 / call_865 Damage
Count 2499
Mean 144630219.06
Minimum 106713040.24
Maximum 183785123.22
Spread ( max - min ) 77072082.98
Range [ ( max - min ) / 2 * 100% ] 26.64%
DTPS
Sample Data arcanocrystal_860 / call_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data arcanocrystal_860 / call_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data arcanocrystal_860 / call_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data arcanocrystal_860 / call_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data arcanocrystal_860 / call_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data arcanocrystal_860 / call_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data arcanocrystal_860 / call_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data arcanocrystal_860 / call_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.56 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.56 auto_attack
0.00 skull_bash
A 2.95 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.20 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 3.76 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 50.74 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 7.55 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 23.10 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 11.23 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 7.59 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.12 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.56 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.98 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.62 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 110.37 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQIQEMJQQQCAOEJN89PQEKQQQQELQPQOEJQQQELOQCPEJOQQQEIOPQEJOQPQEKOCQQQEJOEMLPQQQEJOPQCEOIQQQPEJOQQQEJOPQEICN89QQEJPQQEKOQQPEJMOELOCQQEJOPQEKOQQEJOPQQQCAEJOPQEKOQQQELQQQQEJOPQEKOCQPQEJOQEMLQQPEJOQQPECIN89QQQEJQQOPEOJQQPCQQEIOQQQEJOPQQEJMOPEIOCQQQEJOPQEKOQQQEDOPCQQELOQQPEKOQQQEDOPQCABEKN89QQQELMPELQQQELOQPQEKCOQQQEDOPQEOKPDQQQCQEOLPQQQE

Sample Sequence Table

time name target resources buffs
Pre flask arcanocrystal_860 / call_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food arcanocrystal_860 / call_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation arcanocrystal_860 / call_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, jacins_ruse, potion_of_the_old_war
0:01.004 lunar_inspiration Fluffy_Pillow 76.7/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, bloodtalons, jacins_ruse, potion_of_the_old_war
0:02.008 shred Fluffy_Pillow 91.3/100: 91% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, jacins_ruse, potion_of_the_old_war
0:03.012 savage_roar Fluffy_Pillow 66.0/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, jacins_ruse, potion_of_the_old_war
0:04.017 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:05.021 healing_touch Fluffy_Pillow 55.3/100: 55% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:05.773 ashamanes_frenzy Fluffy_Pillow 66.2/100: 66% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), savage_roar, jacins_ruse, potion_of_the_old_war
0:06.779 rip Fluffy_Pillow 81.5/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:07.782 shred Fluffy_Pillow 97.8/100: 98% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:08.787 shred Fluffy_Pillow 74.1/100: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:09.792 shred Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:10.797 tigers_fury Fluffy_Pillow 26.7/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:10.797 berserk Fluffy_Pillow 86.7/100: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:10.797 rake Fluffy_Pillow 86.7/150: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:11.800 healing_touch Fluffy_Pillow 100.5/150: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:12.555 rip Fluffy_Pillow 112.8/150: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:13.558 shadowmeld Fluffy_Pillow 129.0/150: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:13.558 rake Fluffy_Pillow 129.0/150: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:13.558 auto_attack Fluffy_Pillow 111.5/150: 74% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:14.562 lunar_inspiration Fluffy_Pillow 142.8/150: 95% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:15.566 shred Fluffy_Pillow 144.1/150: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, potion_of_the_old_war
0:16.569 healing_touch Fluffy_Pillow 140.1/150: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:17.324 savage_roar Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:18.330 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:19.333 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.338 shred Fluffy_Pillow 144.7/150: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:21.342 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.346 healing_touch Fluffy_Pillow 144.7/150: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.103 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar
0:24.107 shred Fluffy_Pillow 139.7/150: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar
0:25.112 lunar_inspiration Fluffy_Pillow 134.3/150: 90% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:26.117 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:27.123 rake Fluffy_Pillow 74.7/100: 75% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_wisps_blessing
0:28.127 healing_touch Fluffy_Pillow 54.3/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_wisps_blessing
0:28.882 Waiting 0.100 sec 65.3/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing, cleansed_wisps_blessing
0:28.982 rip Fluffy_Pillow 66.8/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing, cleansed_wisps_blessing
0:29.987 shred Fluffy_Pillow 81.5/100: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_wisps_blessing
0:30.994 shred Fluffy_Pillow 56.2/100: 56% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_wisps_blessing
0:31.998 Waiting 0.500 sec 30.8/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_wisps_blessing
0:32.498 shred Fluffy_Pillow 38.1/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_wisps_blessing
0:33.502 healing_touch Fluffy_Pillow 52.8/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_wisps_blessing
0:34.254 Waiting 1.500 sec 63.7/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, cleansed_wisps_blessing, jacins_ruse
0:35.754 ferocious_bite Fluffy_Pillow 85.6/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, cleansed_wisps_blessing, jacins_ruse
0:36.760 rake Fluffy_Pillow 50.3/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
0:37.765 Waiting 0.700 sec 30.0/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:38.465 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:39.469 Waiting 1.096 sec 14.8/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:40.565 tigers_fury Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:40.797 lunar_inspiration Fluffy_Pillow 94.2/100: 94% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:41.801 healing_touch Fluffy_Pillow 90.5/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:42.692 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
0:43.696 rake Fluffy_Pillow 96.3/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:44.702 shred Fluffy_Pillow 87.6/100: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:45.706 shred Fluffy_Pillow 58.8/100: 59% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:46.711 Waiting 0.900 sec 30.1/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:47.611 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:48.616 healing_touch Fluffy_Pillow 11.5/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, jacins_ruse
0:51.296 savage_roar Fluffy_Pillow 41.6/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
0:53.068 rake Fluffy_Pillow 21.5/100: 21% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
0:54.072 lunar_inspiration Fluffy_Pillow 32.7/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
0:55.076 Waiting 2.379 sec 14.0/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
0:57.455 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:58.461 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
0:59.355 Waiting 0.563 sec 22.0/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing
0:59.918 rip Fluffy_Pillow 28.4/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing
1:00.923 rake Fluffy_Pillow 39.6/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:01.928 Waiting 2.208 sec 15.9/100: 16% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:04.136 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:05.142 Waiting 1.758 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:06.900 lunar_inspiration Fluffy_Pillow 31.7/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:07.903 Waiting 1.069 sec 13.0/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:08.972 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
1:09.976 healing_touch Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_sisters_blessing
1:10.782 savage_roar Fluffy_Pillow 46.4/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
1:11.787 rake Fluffy_Pillow 58.9/100: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
1:12.793 tigers_fury Fluffy_Pillow 36.5/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
1:12.793 shred Fluffy_Pillow 96.5/100: 96% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
1:13.798 shred Fluffy_Pillow 84.0/100: 84% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
1:14.803 shred Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, cleansed_sisters_blessing, cleansed_wisps_blessing
1:15.809 healing_touch Fluffy_Pillow 59.1/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, cleansed_sisters_blessing, cleansed_wisps_blessing
1:16.614 Waiting 1.500 sec 69.2/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_ancients_blessing, cleansed_sisters_blessing, cleansed_wisps_blessing
1:18.114 rip Fluffy_Pillow 87.9/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_ancients_blessing, cleansed_sisters_blessing, cleansed_wisps_blessing
1:19.117 rake Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, cleansed_sisters_blessing, cleansed_wisps_blessing
1:20.122 healing_touch Fluffy_Pillow 48.0/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, cleansed_sisters_blessing, cleansed_wisps_blessing
1:20.930 ashamanes_frenzy Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
1:21.934 Waiting 1.400 sec 70.6/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
1:23.334 ferocious_bite Fluffy_Pillow 88.0/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
1:24.340 lunar_inspiration Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
1:25.346 Waiting 0.600 sec 33.1/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
1:25.946 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
1:26.950 Waiting 2.248 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
1:29.198 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:30.203 shred Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
1:31.209 healing_touch Fluffy_Pillow 23.7/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:32.105 rip Fluffy_Pillow 33.8/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:34.901 rake Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:35.906 Waiting 1.706 sec 11.5/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:37.612 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:38.617 Waiting 2.567 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:41.184 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
1:42.190 Waiting 1.158 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:43.348 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:43.348 healing_touch Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
1:44.243 rake Fluffy_Pillow 95.0/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
1:45.248 savage_roar Fluffy_Pillow 86.3/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, ashamanes_energy, tigers_fury
1:46.253 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:47.257 shred Fluffy_Pillow 86.3/100: 86% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
1:48.263 shred Fluffy_Pillow 57.6/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:49.269 Waiting 0.200 sec 28.9/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:49.469 lunar_inspiration Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:50.475 healing_touch Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:51.369 Waiting 0.729 sec 22.4/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:52.098 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:55.398 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:56.403 Waiting 2.185 sec 13.9/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:58.588 shred Fluffy_Pillow 38.5/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
1:59.594 shred Fluffy_Pillow 49.8/100: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:00.600 Waiting 1.752 sec 21.0/100: 21% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:02.352 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:03.358 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:04.212 Waiting 0.737 sec 22.0/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse
2:04.949 rip Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse
2:07.742 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:08.748 Waiting 1.409 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:10.157 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, cleansed_sisters_blessing, jacins_ruse
2:11.162 Waiting 0.899 sec 13.8/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, cleansed_sisters_blessing, jacins_ruse
2:12.061 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, cleansed_sisters_blessing, jacins_ruse
2:13.066 healing_touch Fluffy_Pillow 37.5/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, cleansed_ancients_blessing, cleansed_sisters_blessing, jacins_ruse
2:13.872 savage_roar Fluffy_Pillow 47.6/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), cleansed_ancients_blessing, jacins_ruse
2:14.877 tigers_fury Fluffy_Pillow 18.9/100: 19% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
2:14.877 shadowmeld Fluffy_Pillow 78.9/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
2:14.877 rake Fluffy_Pillow 78.9/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, clearcasting, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
2:14.877 auto_attack Fluffy_Pillow 78.9/100: 79% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
2:15.881 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
2:16.887 shred Fluffy_Pillow 86.3/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
2:17.891 healing_touch Fluffy_Pillow 72.6/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
2:18.785 Waiting 0.600 sec 82.6/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
2:19.385 rip Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
2:20.390 lunar_inspiration Fluffy_Pillow 70.6/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
2:21.394 shred Fluffy_Pillow 51.9/100: 52% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
2:22.398 Waiting 1.410 sec 23.6/100: 24% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, cleansed_sisters_blessing, jacins_ruse
2:23.808 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:24.813 healing_touch Fluffy_Pillow 13.8/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:25.619 Waiting 1.800 sec 23.8/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse
2:27.419 savage_roar Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse
2:28.423 rake Fluffy_Pillow 58.8/100: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:29.427 Waiting 0.300 sec 36.3/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:29.727 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:30.731 Waiting 2.391 sec 12.6/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:33.122 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:34.126 Waiting 1.626 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:35.752 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:36.757 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:37.652 Waiting 0.273 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:37.925 rip Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:38.930 ashamanes_frenzy Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:39.934 rake Fluffy_Pillow 47.5/100: 48% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
2:40.938 healing_touch Fluffy_Pillow 58.8/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:41.833 Waiting 0.100 sec 68.9/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:41.933 ferocious_bite Fluffy_Pillow 70.0/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:42.938 Waiting 0.100 sec 31.3/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:43.295 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:44.300 Waiting 1.197 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:45.497 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:45.497 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:46.501 shred Fluffy_Pillow 71.3/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:47.505 healing_touch Fluffy_Pillow 57.5/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:48.401 Waiting 0.600 sec 67.6/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:49.001 rip Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:50.004 rake Fluffy_Pillow 70.6/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:51.009 lunar_inspiration Fluffy_Pillow 48.1/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:52.013 Waiting 0.800 sec 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:52.813 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:53.817 healing_touch Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:54.622 Waiting 0.545 sec 23.2/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_sisters_blessing
2:55.167 savage_roar Fluffy_Pillow 30.0/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_sisters_blessing
2:56.173 rake Fluffy_Pillow 42.5/100: 43% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:57.176 shred Fluffy_Pillow 20.1/100: 20% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:58.179 Waiting 0.600 sec 32.6/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:58.779 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:59.784 healing_touch Fluffy_Pillow 12.6/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:00.650 Waiting 5.910 sec 22.6/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:06.560 rip Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:07.564 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:08.567 lunar_inspiration Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:09.569 Waiting 1.100 sec 27.8/100: 28% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:10.669 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:11.674 Waiting 2.412 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:14.086 shred Fluffy_Pillow 38.5/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
3:15.090 shred Fluffy_Pillow 49.7/100: 50% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:16.094 tigers_fury Fluffy_Pillow 21.0/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:16.094 berserk Fluffy_Pillow 81.0/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:16.094 healing_touch Fluffy_Pillow 81.0/150: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:16.988 rip Fluffy_Pillow 91.0/150: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury
3:17.991 rake Fluffy_Pillow 102.3/150: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:18.995 lunar_inspiration Fluffy_Pillow 111.1/150: 74% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:20.000 shred Fluffy_Pillow 122.3/150: 82% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:21.004 healing_touch Fluffy_Pillow 113.6/150: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:21.897 savage_roar Fluffy_Pillow 123.6/150: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury
3:22.903 rake Fluffy_Pillow 115.9/150: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
3:23.908 shred Fluffy_Pillow 111.0/150: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
3:24.912 shred Fluffy_Pillow 103.5/150: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:25.917 shred Fluffy_Pillow 96.1/150: 64% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:26.921 healing_touch Fluffy_Pillow 88.6/150: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:27.727 ferocious_bite Fluffy_Pillow 98.6/150: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, cleansed_sisters_blessing
3:28.731 shred Fluffy_Pillow 86.2/150: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:29.735 shred Fluffy_Pillow 98.7/150: 66% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:30.740 shred Fluffy_Pillow 91.2/150: 61% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:31.746 shred Fluffy_Pillow 83.8/100: 84% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:32.750 healing_touch Fluffy_Pillow 55.5/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:33.645 Waiting 0.900 sec 65.6/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:34.545 rip Fluffy_Pillow 75.7/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:35.547 rake Fluffy_Pillow 56.9/100: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:36.552 lunar_inspiration Fluffy_Pillow 33.2/100: 33% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:37.557 Waiting 0.937 sec 14.5/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:38.494 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
3:39.498 healing_touch Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:40.393 Waiting 2.800 sec 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:43.193 savage_roar Fluffy_Pillow 77.7/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:44.198 rake Fluffy_Pillow 49.0/100: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:45.203 Waiting 0.700 sec 25.3/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:45.903 tigers_fury Fluffy_Pillow 33.2/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:46.094 shred Fluffy_Pillow 95.3/100: 95% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:47.099 lunar_inspiration Fluffy_Pillow 81.6/100: 82% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:48.104 shred Fluffy_Pillow 77.9/100: 78% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:49.108 healing_touch Fluffy_Pillow 64.1/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
3:50.003 Waiting 1.300 sec 74.2/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
3:51.303 rip Fluffy_Pillow 88.8/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
3:52.307 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
3:53.311 shred Fluffy_Pillow 76.3/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
3:54.315 healing_touch Fluffy_Pillow 47.5/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
3:55.210 ashamanes_frenzy Fluffy_Pillow 57.6/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons(2), savage_roar
3:56.214 Waiting 1.800 sec 68.9/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar
3:58.014 ferocious_bite Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar
3:59.020 shred Fluffy_Pillow 75.4/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
4:00.026 shred Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:01.031 Waiting 1.130 sec 17.9/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:02.161 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:03.166 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:04.059 Waiting 0.774 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:04.833 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:07.370 rake Fluffy_Pillow 29.1/100: 29% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:08.375 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:09.379 Waiting 2.590 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:11.969 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, jacins_ruse
4:12.973 Waiting 1.660 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, jacins_ruse
4:14.633 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, jacins_ruse
4:15.638 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, jacins_ruse
4:16.533 tigers_fury Fluffy_Pillow 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
4:16.533 savage_roar Fluffy_Pillow 81.9/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, jacins_ruse
4:17.537 shadowmeld Fluffy_Pillow 68.8/100: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
4:17.537 rake Fluffy_Pillow 68.8/100: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
4:17.537 auto_attack Fluffy_Pillow 33.8/100: 34% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
4:18.539 shred Fluffy_Pillow 61.3/100: 61% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
4:19.544 shred Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
4:20.547 shred Fluffy_Pillow 61.4/100: 61% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
4:21.551 healing_touch Fluffy_Pillow 33.9/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
4:22.355 Waiting 1.300 sec 43.9/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
4:23.655 rip Fluffy_Pillow 60.2/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
4:24.661 shred Fluffy_Pillow 72.7/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
4:25.664 shred Fluffy_Pillow 45.2/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:26.668 Waiting 0.979 sec 17.8/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:28.411 rake Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:29.417 Waiting 1.469 sec 14.1/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:30.886 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:31.892 Waiting 2.267 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:34.159 healing_touch Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:35.054 rake Fluffy_Pillow 47.4/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
4:36.057 Waiting 4.220 sec 23.6/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
4:40.277 rip Fluffy_Pillow 71.0/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar
4:41.281 shred Fluffy_Pillow 82.3/100: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness
4:42.284 shred Fluffy_Pillow 53.5/100: 54% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness
4:43.288 Waiting 0.500 sec 24.8/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
4:43.788 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
4:44.793 Waiting 1.584 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:46.377 tigers_fury Fluffy_Pillow 29.5/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:46.533 shred Fluffy_Pillow 91.2/100: 91% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:47.537 shred Fluffy_Pillow 77.5/100: 78% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:48.541 healing_touch Fluffy_Pillow 63.8/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury
4:49.436 savage_roar Fluffy_Pillow 73.8/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, tigers_fury
4:50.441 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
4:51.445 shred Fluffy_Pillow 76.3/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:52.449 shred Fluffy_Pillow 47.5/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
4:53.455 Waiting 0.549 sec 18.8/100: 19% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:54.004 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
4:55.010 healing_touch Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:55.879 Waiting 2.100 sec 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
4:57.979 rip Fluffy_Pillow 72.5/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
4:58.982 rake Fluffy_Pillow 55.0/100: 55% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
4:59.987 lunar_inspiration Fluffy_Pillow 32.6/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
5:00.991 shred Fluffy_Pillow 15.1/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
5:01.995 Waiting 1.000 sec 27.6/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
5:02.995 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
5:03.999 healing_touch Fluffy_Pillow 12.6/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
5:04.806 Waiting 4.283 sec 22.7/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
5:09.089 rip Fluffy_Pillow 71.9/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:10.093 ashamanes_frenzy Fluffy_Pillow 53.1/100: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:11.215 rake Fluffy_Pillow 65.7/100: 66% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
5:12.220 lunar_inspiration Fluffy_Pillow 77.0/100: 77% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:13.225 healing_touch Fluffy_Pillow 58.3/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:14.121 savage_roar Fluffy_Pillow 68.4/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
5:15.123 rake Fluffy_Pillow 39.6/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:16.129 Waiting 0.810 sec 15.9/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:16.939 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:16.939 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:17.944 shred Fluffy_Pillow 71.3/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:18.949 shred Fluffy_Pillow 57.6/100: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:19.954 healing_touch Fluffy_Pillow 43.8/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:20.849 Waiting 2.600 sec 53.9/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:23.449 rip Fluffy_Pillow 83.1/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
5:24.453 rake Fluffy_Pillow 94.3/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
5:25.458 lunar_inspiration Fluffy_Pillow 70.6/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:26.463 shred Fluffy_Pillow 51.9/100: 52% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:27.469 healing_touch Fluffy_Pillow 23.2/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:28.365 Waiting 3.300 sec 33.3/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
5:31.665 savage_roar Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing
5:32.670 rake Fluffy_Pillow 81.6/100: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:33.675 shred Fluffy_Pillow 57.9/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:34.679 Waiting 1.000 sec 29.1/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:35.679 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:36.685 Waiting 1.490 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:38.175 shred Fluffy_Pillow 28.4/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:39.180 healing_touch Fluffy_Pillow 39.6/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:40.075 Waiting 1.300 sec 49.7/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:41.375 ferocious_bite Fluffy_Pillow 64.3/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:43.402 rake Fluffy_Pillow 37.0/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:44.406 Waiting 1.541 sec 13.3/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:45.947 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:46.951 tigers_fury Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:46.951 shred Fluffy_Pillow 71.9/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:47.956 shred Fluffy_Pillow 58.2/100: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:48.960 healing_touch Fluffy_Pillow 44.4/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:49.855 Waiting 1.700 sec 54.5/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:51.555 ferocious_bite Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, cleansed_sisters_blessing
5:52.558 rake Fluffy_Pillow 76.1/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
5:53.563 shred Fluffy_Pillow 53.7/100: 54% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
5:54.567 Waiting 1.000 sec 26.2/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
5:55.567 shred Fluffy_Pillow 38.7/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_sisters_blessing
5:56.571 lunar_inspiration Fluffy_Pillow 51.2/100: 51% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
5:57.575 healing_touch Fluffy_Pillow 33.7/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
5:58.380 Waiting 3.700 sec 43.8/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
6:02.080 savage_roar Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing
6:03.084 rake Fluffy_Pillow 60.5/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_wisps_blessing
6:04.089 Waiting 0.300 sec 36.8/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing
6:04.389 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing
6:05.392 Waiting 1.208 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
6:06.600 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
6:07.604 Waiting 0.400 sec 36.3/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
6:08.004 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
6:09.010 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
6:09.904 ferocious_bite Fluffy_Pillow 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_wisps_blessing, jacins_ruse
6:10.909 rake Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
6:11.916 Waiting 0.715 sec 22.6/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:12.631 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:13.635 Waiting 2.568 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:16.203 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:17.209 tigers_fury Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:17.209 berserk Fluffy_Pillow 72.0/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:17.209 potion Fluffy_Pillow 72.0/150: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:17.209 healing_touch Fluffy_Pillow 72.0/150: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:18.103 savage_roar Fluffy_Pillow 82.0/150: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:19.108 shadowmeld Fluffy_Pillow 88.3/150: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:19.108 rake Fluffy_Pillow 88.3/150: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:19.108 auto_attack Fluffy_Pillow 70.8/150: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:20.111 shred Fluffy_Pillow 97.1/150: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:21.115 shred Fluffy_Pillow 123.3/150: 82% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:22.119 shred Fluffy_Pillow 114.6/150: 76% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:23.123 healing_touch Fluffy_Pillow 105.9/150: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:24.018 ferocious_bite Fluffy_Pillow 115.9/150: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:25.022 ashamanes_frenzy Fluffy_Pillow 102.2/150: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:26.213 lunar_inspiration Fluffy_Pillow 115.6/150: 77% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:27.217 healing_touch Fluffy_Pillow 111.8/150: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:28.112 ferocious_bite Fluffy_Pillow 121.9/150: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:29.117 shred Fluffy_Pillow 108.2/150: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:30.121 shred Fluffy_Pillow 119.4/150: 80% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:31.125 shred Fluffy_Pillow 130.7/150: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:32.128 healing_touch Fluffy_Pillow 122.0/150: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:33.024 ferocious_bite Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:34.029 rake Fluffy_Pillow 61.3/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:35.033 Waiting 0.300 sec 37.6/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:35.333 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:36.337 Waiting 1.641 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:37.978 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:38.982 Waiting 2.568 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:41.550 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:42.553 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:43.447 Waiting 1.667 sec 22.0/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:45.114 savage_roar Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:47.138 tigers_fury Fluffy_Pillow 23.4/100: 23% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:47.209 rake Fluffy_Pillow 84.2/100: 84% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:48.213 shred Fluffy_Pillow 75.5/100: 75% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:49.218 shred Fluffy_Pillow 61.8/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:50.222 shred Fluffy_Pillow 48.0/100: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
6:51.227 healing_touch Fluffy_Pillow 19.3/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:52.123 ferocious_bite Fluffy_Pillow 29.4/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
6:55.431 rake Fluffy_Pillow 37.1/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:56.436 Waiting 1.532 sec 13.4/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:57.968 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:58.973 Waiting 2.567 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:01.540 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:02.546 Waiting 1.158 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:03.704 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:04.600 rake Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:05.605 Waiting 1.217 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar, jacins_ruse
7:06.822 savage_roar Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar
7:07.827 lunar_inspiration Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
7:08.832 ferocious_bite Fluffy_Pillow 47.6/100: 48% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:09.836 Waiting 2.623 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:12.459 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:13.464 Waiting 1.158 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:14.622 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
7:15.627 Waiting 0.400 sec 36.3/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:16.027 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:17.032 tigers_fury Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:17.209 shred Fluffy_Pillow 74.0/100: 74% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:18.213 healing_touch Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:19.106 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
7:20.112 Waiting 1.100 sec 61.6/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
7:21.212 ferocious_bite Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, tigers_fury
7:22.217 lunar_inspiration Fluffy_Pillow 50.2/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
7:23.223 Waiting 0.800 sec 31.5/100: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
7:24.023 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
7:25.028 Waiting 2.576 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
7:27.604 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:28.608 shred Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
7:29.614 healing_touch Fluffy_Pillow 23.3/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 37.02% 37.02% 7356
Haste 12.25% 12.25% 3981
Damage / Heal Versatility 7.65% 7.65% 3058
Attack Power 21649 19943 0
Mastery 58.18% 56.04% 7007
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 847.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Trinket2 Nature's Call
ilevel: 865, stats: { +329 Mastery, +329 Haste, +329 Crit }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="arcanocrystal_860 / call_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=unstable_arcanocrystal,id=141482
trinket2=natures_call,id=139334,bonus_id=1805
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=846.56
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=7356
# gear_haste_rating=2654
# gear_mastery_rating=7007
# gear_versatility_rating=3058
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

arcanocrystal_860 / pod_865 : 321130 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
321129.6 321129.6 398.3 / 0.124% 39352.9 / 12.3% 21097.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.2 15.2 Energy 30.23% 45.0 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcanocrystal_860 / pod_865 321130
Ashamane's Frenzy 14876 4.6% 6.1 78.37sec 1094501 1089662 Direct 91.4 9987 19974 13595 36.1%  
Periodic 30.2 132099 264251 180198 36.4% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.11 91.43 121.68 30.24 1.0045 0.6474 6692706.94 7277043.70 8.03 78817.47 1089662.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.41 63.88% 9987.24 7435 11859 9988.37 9033 11115 583311 857523 31.98
crit 33.03 36.12% 19974.06 14870 23719 19976.83 17995 22328 659708 969833 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.2 63.60% 132099.46 81974 163449 132100.80 120310 146544 2540896 2540896 0.00
crit 11.0 36.40% 264251.29 163948 326898 264342.30 226913 306489 2908792 2908792 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 38094 11.9% 18.9 22.53sec 907142 0 Periodic 150.3 83857 167821 114177 36.1% 43.1%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.91 0.00 150.25 150.25 0.0000 1.2910 17155107.72 17155107.72 0.00 88442.52 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.0 63.89% 83857.19 58 99005 83772.16 74641 92567 8049910 8049910 0.00
crit 54.3 36.11% 167821.17 116 198011 167654.98 144385 184075 9105197 9105197 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 29911 9.3% 531.5 0.85sec 25321 29985 Direct 531.5 18614 37231 25321 36.0%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 531.46 531.46 0.00 0.00 0.8445 0.0000 13457039.50 19783122.76 31.98 29984.56 29984.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 340.01 63.98% 18614.22 14488 20826 18613.80 18270 18889 6328933 9304131 31.98
crit 191.46 36.02% 37230.97 28976 41653 37230.46 36257 37893 7128106 10478992 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 7326 2.3% 11.4 41.34sec 288952 287678 Direct 11.4 200373 444341 288940 36.3%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.39 11.39 0.00 0.00 1.0045 0.0000 3291325.62 4838560.43 31.98 287678.14 287678.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.26 63.70% 200373.42 15321 256019 200121.23 47405 256019 1453741 2137138 31.98
crit 4.14 36.30% 444341.22 34301 565803 440611.99 0 565803 1837584 2701423 31.72
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Infested Ground 5475 1.7% 7.9 60.68sec 313582 0 Direct 77.7 23295 46641 31709 36.0%  

Stats details: infested_ground

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.85 77.67 0.00 0.00 0.0000 0.0000 2462855.37 2462855.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.68 63.97% 23295.42 17045 24501 23296.68 21628 24026 1157407 1157407 0.00
crit 27.99 36.03% 46640.95 34089 49003 46639.17 43712 48683 1305448 1305448 0.00
 
 

Action details: infested_ground

Static Values
  • id:221803
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221803
  • name:Infested Ground
  • school:shadow
  • tooltip:
  • description:Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.
 
Moonfire (lunar_inspiration) 23837 7.4% 31.7 14.31sec 338719 337203 Direct 31.7 33682 67358 45873 36.2%  
Periodic 263.8 25844 51674 35155 36.0% 97.1%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.66 31.66 263.78 263.78 1.0045 1.6564 10725428.90 10725428.90 0.00 22881.65 337203.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.20 63.80% 33681.92 26218 37689 33679.54 31555 35454 680456 680456 0.00
crit 11.46 36.20% 67357.93 52436 75377 67354.21 58991 73739 772047 772047 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 168.7 63.96% 25844.13 706 29314 25843.91 24807 26643 4359970 4359970 0.00
crit 95.1 36.04% 51674.12 1411 58627 51669.35 48817 53372 4912956 4912956 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2349 0.7% 25.4 17.60sec 41542 0 Periodic 75.1 14054 0 14054 0.0% 8.3%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.42 0.00 75.13 75.13 0.0000 0.4969 1055955.00 1552353.87 31.98 28282.49 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.1 100.00% 14054.38 22 15789 14057.28 12979 14845 1055955 1552354 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 12052 3.7% 24.6 16.44sec 217334 0 Direct 24.6 159381 319368 217338 36.2%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.63 24.63 0.00 0.00 0.0000 0.0000 5352905.92 7869278.75 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.71 63.78% 159381.28 124406 178834 159358.23 147214 169862 2503595 3680522 31.98
crit 8.92 36.22% 319368.28 248812 357668 319483.04 261253 357668 2849311 4188757 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 70994 22.1% 47.5 9.49sec 672387 669385 Direct 47.5 85941 171859 116753 35.9%  
Periodic 223.8 86680 173519 117921 36.0% 95.2%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.50 47.50 223.81 223.81 1.0045 1.9145 31937690.76 31937690.76 0.00 67069.50 669384.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.46 64.14% 85941.21 40197 192359 85954.08 74334 97965 2618045 2618045 0.00
crit 17.04 35.86% 171859.41 80394 384718 171872.54 132397 214502 2927713 2927713 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.3 64.02% 86679.70 38 192359 86704.08 77024 95664 12419818 12419818 0.00
crit 80.5 35.98% 173518.82 75 384718 173566.47 146576 202779 13972115 13972115 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 85344 26.6% 23.1 15.26sec 1663750 1656336 Periodic 327.6 86174 172424 117259 36.0% 96.6%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.09 0.00 327.64 327.64 1.0045 1.3264 38418712.56 38418712.56 0.00 83923.78 1656335.96
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 209.6 63.96% 86174.35 58 99005 86174.51 81538 89710 18058109 18058109 0.00
crit 118.1 36.04% 172424.32 116 198011 172405.33 158678 181299 20360603 20360603 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 30873 9.6% 112.9 3.98sec 122930 122379 Direct 112.9 90435 180810 122935 36.0%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.89 112.89 0.00 0.00 1.0045 0.0000 13877903.12 20401832.14 31.98 122379.02 122379.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.30 64.05% 90434.58 63161 136190 90448.01 84313 96376 6538644 9612427 31.98
crit 40.59 35.95% 180810.40 126321 272380 180729.06 163792 200024 7339259 10789406 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
arcanocrystal_860 / pod_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / pod_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.02sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / pod_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcanocrystal_860 / pod_865
  • harmful:false
  • if_expr:
 
Healing Touch 51.8 8.79sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 51.77 0.00 0.00 0.00 0.8416 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.8 24.42sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.80 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.08sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.34sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.18% 45.4(45.4) 15.1

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 14.58% 0.0(0.0) 2.9

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 51.7 0.0 8.8sec 8.8sec 46.08% 46.12% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.50%
  • bloodtalons_2:27.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 44.9 1.6 9.9sec 9.5sec 6.61% 15.36% 1.6(1.6) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.61%

Trigger Attempt Success

  • trigger_pct:8.74%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.8 63.7sec 48.2sec 24.69% 24.77% 1.8(1.8) 6.4

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Leeching Pestilence 7.9 0.0 60.7sec 60.7sec 17.29% 17.37% 0.0(0.0) 7.7

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_leeching_pestilence
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:leech_rating
  • amount:1771.29

Stack Uptimes

  • leeching_pestilence_1:17.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221805
  • name:Leeching Pestilence
  • tooltip:Leech increased by $w1.
  • description:{$@spelldesc221803=Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.5sec 0.0sec 10.81% 10.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 51.5 1.1 8.7sec 8.5sec 74.39% 74.41% 1.1(1.1) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.39%

Trigger Attempt Success

  • trigger_pct:98.74%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 7.6 11.2 51.3sec 24.4sec 94.29% 93.94% 202.0(202.0) 6.6

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:94.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 132.9sec 132.9sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.81% 28.94% 0.0(0.0) 14.9

Buff details

  • buff initial source:arcanocrystal_860 / pod_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
arcanocrystal_860 / pod_865
ferocious_bite Energy 22.8 391.4 17.2 34.4 8410.2
ferocious_bite Combo Points 11.4 53.6 4.7 4.7 61423.3
lunar_inspiration Energy 31.7 784.8 24.8 24.8 13667.0
rake Energy 47.5 1353.1 28.5 28.5 23603.3
rip Energy 23.1 466.4 20.2 20.2 82374.5
rip Combo Points 23.1 115.5 5.0 5.0 332740.1
savage_roar Energy 18.8 483.1 25.7 25.7 0.0
savage_roar Combo Points 18.8 94.0 5.0 5.0 0.0
shred Energy 112.9 3366.9 29.8 29.8 4121.8
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.50 47.50 (17.84%) 1.00 0.00 0.00%
tigers_fury Energy 15.21 911.83 (10.94%) 59.96 0.57 0.06%
ashamanes_frenzy Combo Points 6.11 18.34 (6.89%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.66 31.66 (11.89%) 1.00 0.00 0.00%
shred Combo Points 112.89 112.89 (42.40%) 1.00 0.00 0.00%
energy_regen Energy 2107.46 5238.96 (62.83%) 2.49 84.85 1.59%
clearcasting Energy 44.79 1526.78 (18.31%) 34.09 0.00 0.00%
ashamanes_energy Energy 45.43 661.04 (7.93%) 14.55 20.38 2.99%
primal_fury Combo Points 69.09 55.87 (20.98%) 0.81 13.22 19.14%
Resource RPS-Gain RPS-Loss
Energy 15.14 15.21
Combo Points 0.59 0.58
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 37.28 0.02 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.31 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.0%

Procs

Count Interval
clearcasting 46.4 9.5sec
clearcasting_wasted 1.6 119.6sec
primal_fury 69.1 6.5sec

Statistics & Data Analysis

Fight Length
Sample Data arcanocrystal_860 / pod_865 Fight Length
Count 2499
Mean 450.05
Minimum 360.07
Maximum 539.96
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data arcanocrystal_860 / pod_865 Damage Per Second
Count 2499
Mean 321129.60
Minimum 285556.62
Maximum 353982.73
Spread ( max - min ) 68426.12
Range [ ( max - min ) / 2 * 100% ] 10.65%
Standard Deviation 10159.0096
5th Percentile 304773.25
95th Percentile 337994.70
( 95th Percentile - 5th Percentile ) 33221.45
Mean Distribution
Standard Deviation 203.2208
95.00% Confidence Intervall ( 320731.29 - 321527.90 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3844
0.1 Scale Factor Error with Delta=300 881021
0.05 Scale Factor Error with Delta=300 3524085
0.01 Scale Factor Error with Delta=300 88102130
Priority Target DPS
Sample Data arcanocrystal_860 / pod_865 Priority Target Damage Per Second
Count 2499
Mean 321129.60
Minimum 285556.62
Maximum 353982.73
Spread ( max - min ) 68426.12
Range [ ( max - min ) / 2 * 100% ] 10.65%
Standard Deviation 10159.0096
5th Percentile 304773.25
95th Percentile 337994.70
( 95th Percentile - 5th Percentile ) 33221.45
Mean Distribution
Standard Deviation 203.2208
95.00% Confidence Intervall ( 320731.29 - 321527.90 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3844
0.1 Scale Factor Error with Delta=300 881021
0.05 Scale Factor Error with Delta=300 3524085
0.01 Scale Factor Error with Delta=300 88102130
DPS(e)
Sample Data arcanocrystal_860 / pod_865 Damage Per Second (Effective)
Count 2499
Mean 321129.60
Minimum 285556.62
Maximum 353982.73
Spread ( max - min ) 68426.12
Range [ ( max - min ) / 2 * 100% ] 10.65%
Damage
Sample Data arcanocrystal_860 / pod_865 Damage
Count 2499
Mean 144427631.43
Minimum 105164791.11
Maximum 182203266.51
Spread ( max - min ) 77038475.40
Range [ ( max - min ) / 2 * 100% ] 26.67%
DTPS
Sample Data arcanocrystal_860 / pod_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data arcanocrystal_860 / pod_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data arcanocrystal_860 / pod_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data arcanocrystal_860 / pod_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data arcanocrystal_860 / pod_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data arcanocrystal_860 / pod_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data arcanocrystal_860 / pod_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data arcanocrystal_860 / pod_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.59 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.59 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 7.85 use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
C 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
D 15.21 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
E 3.74 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
F 50.77 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
J 7.55 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
K 23.09 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
L 11.25 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
M 7.65 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
N 6.11 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
O 3.59 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
P 42.91 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
Q 31.66 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
R 112.89 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789QRDABJRRFNKRRPQFMPRRRFKRRRQRFJPRDRRRFKO89QRRFKRPQFJPRRDBRRFKPQRRFKPQFRPJRDRFNKQRRPFLPRQRFKPRQFDBKPRRFLRPRQFPKRQRDPFKO89RRFJRQRFKNPRFLPDABQRRFKPRRRRFMPQRRFKPRRQFJDPRRRFKPQRFKPQRRRFDBJPRRFKNQRFLPRRQFKPRRRDFKPRQRFLPRRRFKPQRRFKDBO89RQRRFJRRRRFKPQRRFKNDPFJQPRRFMPQRRFLPRRQFEDABCPRRRFKRRRFLPQRFMRRRRFMPQDRRFLPRRQFMNRRFMPRQRDBFO89LRRREQPRRF

Sample Sequence Table

time name target resources buffs
Pre flask arcanocrystal_860 / pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food arcanocrystal_860 / pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation arcanocrystal_860 / pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, jacins_ruse, potion_of_the_old_war
0:01.003 lunar_inspiration Fluffy_Pillow 77.0/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, jacins_ruse, potion_of_the_old_war
0:02.007 shred Fluffy_Pillow 62.1/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, jacins_ruse, potion_of_the_old_war
0:03.011 tigers_fury Fluffy_Pillow 37.1/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, jacins_ruse, potion_of_the_old_war
0:03.011 berserk Fluffy_Pillow 97.1/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, ashamanes_energy, tigers_fury, jacins_ruse, potion_of_the_old_war
0:03.011 use_item_ravaged_seed_pod Fluffy_Pillow 97.1/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, ashamanes_energy, berserk, tigers_fury, jacins_ruse, potion_of_the_old_war
0:03.011 savage_roar Fluffy_Pillow 97.1/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:04.015 shred Fluffy_Pillow 127.2/150: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:05.021 shred Fluffy_Pillow 137.3/150: 92% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:06.028 healing_touch Fluffy_Pillow 147.3/150: 98% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:06.783 ashamanes_frenzy Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:07.788 rip Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons, berserk, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:08.793 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:09.797 shred Fluffy_Pillow 145.0/150: 97% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:10.801 rake Fluffy_Pillow 140.1/150: 93% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:11.804 lunar_inspiration Fluffy_Pillow 137.6/150: 92% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:12.809 healing_touch Fluffy_Pillow 137.7/150: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:13.563 ferocious_bite Fluffy_Pillow 149.0/150: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
0:14.569 rake Fluffy_Pillow 139.1/150: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:15.574 shred Fluffy_Pillow 136.6/150: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.579 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.583 shred Fluffy_Pillow 145.0/150: 97% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.588 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:19.341 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, potion_of_the_old_war
0:20.348 shred Fluffy_Pillow 85.1/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
0:21.354 shred Fluffy_Pillow 60.2/100: 60% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.359 Waiting 0.400 sec 35.2/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.759 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.763 Waiting 1.082 sec 16.3/100: 16% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.845 lunar_inspiration Fluffy_Pillow 32.5/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:25.851 shred Fluffy_Pillow 17.6/100: 18% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:26.856 healing_touch Fluffy_Pillow 32.6/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:27.611 savage_roar Fluffy_Pillow 43.9/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2)
0:29.895 rake Fluffy_Pillow 38.2/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:30.899 Waiting 1.552 sec 18.2/100: 18% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:32.451 shred Fluffy_Pillow 41.5/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:33.455 tigers_fury Fluffy_Pillow 16.5/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:33.455 shred Fluffy_Pillow 76.5/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.460 shred Fluffy_Pillow 66.6/100: 67% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.464 shred Fluffy_Pillow 96.6/100: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.469 healing_touch Fluffy_Pillow 86.7/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury
0:37.223 rip Fluffy_Pillow 98.0/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, tigers_fury
0:38.226 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:38.226 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:38.226 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.231 lunar_inspiration Fluffy_Pillow 80.1/100: 80% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:40.236 shred Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:41.240 Waiting 0.100 sec 39.0/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
0:41.340 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
0:42.345 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:43.215 Waiting 5.282 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
0:48.497 rip Fluffy_Pillow 82.6/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
0:49.500 shred Fluffy_Pillow 64.2/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:50.504 rake Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:51.507 Waiting 1.598 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:53.105 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, jacins_ruse
0:54.110 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, jacins_ruse
0:54.982 savage_roar Fluffy_Pillow 22.4/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), jacins_ruse
0:56.244 rake Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
0:57.246 Waiting 2.397 sec 13.5/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
0:59.643 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:00.649 Waiting 2.464 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:03.113 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:04.117 tigers_fury Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:04.117 use_item_ravaged_seed_pod Fluffy_Pillow 72.7/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:04.117 shred Fluffy_Pillow 72.7/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:05.122 shred Fluffy_Pillow 59.3/100: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:06.126 healing_touch Fluffy_Pillow 45.9/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:06.998 Waiting 0.900 sec 55.9/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
1:07.898 rip Fluffy_Pillow 81.3/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
1:08.901 rake Fluffy_Pillow 62.9/100: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:09.907 lunar_inspiration Fluffy_Pillow 39.5/100: 39% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:10.911 Waiting 1.744 sec 21.0/100: 21% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:12.655 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
1:13.658 Waiting 2.467 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
1:16.125 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:17.130 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:18.003 Waiting 0.691 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:18.694 rip Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:21.739 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, jacins_ruse
1:22.743 lunar_inspiration Fluffy_Pillow 47.4/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, jacins_ruse
1:23.748 healing_touch Fluffy_Pillow 29.0/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, jacins_ruse
1:24.621 Waiting 0.100 sec 39.1/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), jacins_ruse
1:24.721 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), jacins_ruse
1:27.004 rake Fluffy_Pillow 26.6/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons, jacins_ruse
1:28.264 savage_roar Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points
1:29.270 Waiting 2.468 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
1:31.738 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
1:32.743 Waiting 1.165 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:33.908 tigers_fury Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:34.117 shred Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.122 healing_touch Fluffy_Pillow 75.1/100: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.994 ashamanes_frenzy Fluffy_Pillow 85.2/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:36.998 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, ashamanes_energy, savage_roar, tigers_fury
1:38.002 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
1:39.005 shred Fluffy_Pillow 81.6/100: 82% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:40.008 shred Fluffy_Pillow 53.1/100: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:42.037 rake Fluffy_Pillow 36.5/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
1:43.043 healing_touch Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:43.915 Waiting 2.559 sec 23.2/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:46.474 savage_roar Fluffy_Pillow 52.7/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:47.478 rake Fluffy_Pillow 64.2/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:48.484 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:49.489 Waiting 1.590 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:51.079 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:52.084 Waiting 2.498 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:54.582 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:55.586 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:56.457 Waiting 0.694 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:57.151 rip Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:00.201 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:01.205 shred Fluffy_Pillow 12.5/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
2:02.209 Waiting 0.600 sec 24.1/100: 24% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:02.809 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:03.813 healing_touch Fluffy_Pillow 12.6/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:04.684 tigers_fury Fluffy_Pillow 22.6/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:04.684 use_item_ravaged_seed_pod Fluffy_Pillow 82.6/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:04.684 Waiting 0.600 sec 82.6/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
2:05.284 rip Fluffy_Pillow 89.5/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
2:06.289 rake Fluffy_Pillow 86.1/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:07.294 shred Fluffy_Pillow 77.7/100: 78% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:08.299 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:09.304 healing_touch Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:10.174 Waiting 0.600 sec 81.6/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
2:10.774 savage_roar Fluffy_Pillow 88.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
2:11.777 shred Fluffy_Pillow 60.1/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:13.290 rake Fluffy_Pillow 37.5/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, leeching_pestilence
2:14.294 Waiting 2.344 sec 14.1/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, leeching_pestilence
2:16.638 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:17.640 Waiting 1.568 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:19.208 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:20.212 Waiting 1.098 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:21.310 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:22.182 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
2:23.187 Waiting 3.059 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
2:26.246 rip Fluffy_Pillow 46.9/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
2:27.252 Waiting 1.000 sec 28.5/100: 28% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:28.252 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:29.256 Waiting 1.662 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:30.918 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:31.923 Waiting 2.497 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:34.420 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:35.425 tigers_fury Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:35.425 rake Fluffy_Pillow 72.7/100: 73% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:36.431 healing_touch Fluffy_Pillow 64.3/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:37.303 Waiting 0.200 sec 74.4/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:37.503 rip Fluffy_Pillow 91.7/100: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:38.508 shadowmeld Fluffy_Pillow 88.3/100: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:38.508 rake Fluffy_Pillow 88.3/100: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:38.508 auto_attack Fluffy_Pillow 53.3/100: 53% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:39.513 shred Fluffy_Pillow 64.8/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:40.517 Waiting 0.400 sec 36.4/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
2:40.917 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
2:41.923 healing_touch Fluffy_Pillow 12.6/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
2:43.051 savage_roar Fluffy_Pillow 25.6/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), tigers_fury
2:44.055 Waiting 0.300 sec 37.2/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:44.355 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:45.360 Waiting 1.605 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:46.965 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:47.970 Waiting 2.498 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:50.468 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:51.472 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:52.344 Waiting 0.693 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:53.037 rip Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:54.041 ashamanes_frenzy Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:56.069 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
2:57.073 shred Fluffy_Pillow 47.3/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:58.077 healing_touch Fluffy_Pillow 18.9/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:58.947 Waiting 3.500 sec 28.9/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:02.447 savage_roar Fluffy_Pillow 69.2/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:03.451 rake Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
3:04.456 Waiting 0.759 sec 17.4/100: 17% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:05.215 tigers_fury Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:05.425 berserk Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:05.425 use_item_ravaged_seed_pod Fluffy_Pillow 88.6/150: 59% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:05.425 lunar_inspiration Fluffy_Pillow 88.6/150: 59% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:06.428 shred Fluffy_Pillow 100.1/150: 67% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:07.433 shred Fluffy_Pillow 106.7/150: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:08.437 healing_touch Fluffy_Pillow 113.3/150: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:09.308 rip Fluffy_Pillow 123.3/150: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:10.312 rake Fluffy_Pillow 119.9/150: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:11.316 shred Fluffy_Pillow 114.0/150: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:12.319 shred Fluffy_Pillow 105.5/150: 70% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:13.323 shred Fluffy_Pillow 97.1/150: 65% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:14.327 shred Fluffy_Pillow 88.7/150: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence
3:15.330 healing_touch Fluffy_Pillow 80.3/150: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, leeching_pestilence
3:16.202 ferocious_bite Fluffy_Pillow 90.3/150: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar
3:17.206 rake Fluffy_Pillow 89.4/150: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:18.210 lunar_inspiration Fluffy_Pillow 83.5/150: 56% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar
3:19.214 shred Fluffy_Pillow 80.0/150: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:20.219 shred Fluffy_Pillow 71.6/150: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar
3:21.224 healing_touch Fluffy_Pillow 63.2/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:22.095 Waiting 1.400 sec 73.2/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:23.495 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:24.499 rake Fluffy_Pillow 71.0/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:25.506 shred Fluffy_Pillow 47.6/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:26.510 Waiting 1.908 sec 19.1/100: 19% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:28.418 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:29.422 Waiting 1.565 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:30.987 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:31.991 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
3:34.393 savage_roar Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
3:35.397 tigers_fury Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:35.425 rake Fluffy_Pillow 71.9/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:36.429 shred Fluffy_Pillow 63.5/100: 63% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:37.434 shred Fluffy_Pillow 50.1/100: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:38.438 Waiting 0.300 sec 36.7/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
3:38.738 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
3:39.744 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
3:40.617 Waiting 3.780 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
3:44.397 rip Fluffy_Pillow 65.3/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:45.402 rake Fluffy_Pillow 46.9/100: 47% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:46.407 Waiting 0.628 sec 23.5/100: 24% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:47.035 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:48.038 Waiting 2.499 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:50.537 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:51.542 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:52.416 Waiting 2.991 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:55.407 rip Fluffy_Pillow 57.3/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:56.412 rake Fluffy_Pillow 68.9/100: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:57.415 lunar_inspiration Fluffy_Pillow 45.4/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:58.420 Waiting 1.200 sec 27.0/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
3:59.620 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
4:00.624 Waiting 1.191 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:01.815 shred Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness
4:02.820 Waiting 0.200 sec 37.7/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
4:03.020 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
4:04.023 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:05.405 tigers_fury Fluffy_Pillow 27.5/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
4:05.425 use_item_ravaged_seed_pod Fluffy_Pillow 87.8/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
4:05.425 savage_roar Fluffy_Pillow 87.8/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, leeching_pestilence
4:06.428 rake Fluffy_Pillow 74.3/100: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:07.434 shred Fluffy_Pillow 65.9/100: 66% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:08.437 shred Fluffy_Pillow 92.5/100: 92% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:09.442 healing_touch Fluffy_Pillow 64.1/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:10.314 Waiting 1.300 sec 74.1/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
4:11.614 rip Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
4:12.619 ashamanes_frenzy Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:13.624 lunar_inspiration Fluffy_Pillow 82.3/100: 82% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, leeching_pestilence
4:14.628 shred Fluffy_Pillow 63.9/100: 64% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, leeching_pestilence
4:15.633 healing_touch Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:16.506 Waiting 2.500 sec 45.5/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:19.006 savage_roar Fluffy_Pillow 74.3/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:20.011 rake Fluffy_Pillow 45.9/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:21.014 Waiting 1.618 sec 22.5/100: 22% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:22.632 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:23.637 shred Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
4:24.642 Waiting 0.600 sec 24.3/100: 24% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:25.242 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:26.246 healing_touch Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:27.118 Waiting 1.486 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:28.604 rip Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:30.884 rake Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:31.889 Waiting 1.153 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:33.042 shred Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
4:34.046 shred Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
4:35.049 shred Fluffy_Pillow 49.3/100: 49% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:36.053 tigers_fury Fluffy_Pillow 20.9/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:36.053 healing_touch Fluffy_Pillow 80.9/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:36.925 rip Fluffy_Pillow 90.9/100: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
4:37.928 rake Fluffy_Pillow 87.5/100: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:38.933 shred Fluffy_Pillow 79.1/100: 79% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:39.936 lunar_inspiration Fluffy_Pillow 65.6/100: 66% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
4:40.942 shred Fluffy_Pillow 47.2/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:41.947 healing_touch Fluffy_Pillow 18.8/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:42.819 Waiting 4.000 sec 28.9/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:46.819 savage_roar Fluffy_Pillow 75.0/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:47.824 rake Fluffy_Pillow 86.6/100: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:48.828 shred Fluffy_Pillow 63.1/100: 63% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:49.832 shred Fluffy_Pillow 74.7/100: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:50.837 shred Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:51.840 healing_touch Fluffy_Pillow 17.9/100: 18% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:52.709 Waiting 5.200 sec 27.9/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:57.909 rip Fluffy_Pillow 87.8/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:58.913 rake Fluffy_Pillow 69.4/100: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:59.918 lunar_inspiration Fluffy_Pillow 46.0/100: 46% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:00.923 Waiting 1.100 sec 27.6/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:02.023 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:03.029 Waiting 2.041 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:05.070 shred Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
5:06.074 healing_touch Fluffy_Pillow 46.9/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:06.945 rip Fluffy_Pillow 57.0/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:07.949 tigers_fury Fluffy_Pillow 38.6/100: 39% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:07.949 use_item_ravaged_seed_pod Fluffy_Pillow 98.6/100: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:07.949 shadowmeld Fluffy_Pillow 98.6/100: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:07.949 rake Fluffy_Pillow 98.6/100: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:07.949 auto_attack Fluffy_Pillow 63.6/100: 64% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:08.953 shred Fluffy_Pillow 90.1/100: 90% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:09.957 lunar_inspiration Fluffy_Pillow 76.7/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:10.961 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:11.965 shred Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:12.968 healing_touch Fluffy_Pillow 43.1/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:13.840 Waiting 0.400 sec 53.2/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:14.240 savage_roar Fluffy_Pillow 57.8/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, leeching_pestilence, jacins_ruse
5:15.243 Waiting 1.000 sec 29.4/100: 29% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:16.243 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, leeching_pestilence
5:17.248 shred Fluffy_Pillow 12.5/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, leeching_pestilence
5:18.252 Waiting 1.000 sec 24.1/100: 24% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:19.252 shred Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
5:20.256 shred Fluffy_Pillow 47.2/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:21.261 healing_touch Fluffy_Pillow 18.7/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:22.132 Waiting 0.200 sec 28.8/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:22.332 rip Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:25.383 rake Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:26.387 lunar_inspiration Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
5:27.390 Waiting 1.400 sec 24.4/100: 24% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:28.790 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:29.792 Waiting 2.519 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:32.311 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:33.318 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:34.190 Waiting 1.091 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:35.281 rip Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:36.286 ashamanes_frenzy Fluffy_Pillow 17.0/100: 17% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:37.802 tigers_fury Fluffy_Pillow 34.4/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:37.949 rake Fluffy_Pillow 96.1/100: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:38.951 healing_touch Fluffy_Pillow 87.7/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:39.822 savage_roar Fluffy_Pillow 97.7/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury
5:40.827 lunar_inspiration Fluffy_Pillow 84.3/100: 84% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:41.832 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
5:42.835 shred Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:43.838 shred Fluffy_Pillow 48.1/100: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:44.842 healing_touch Fluffy_Pillow 19.7/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:45.713 Waiting 5.100 sec 29.7/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:50.813 ferocious_bite Fluffy_Pillow 88.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:51.817 rake Fluffy_Pillow 75.1/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:52.821 lunar_inspiration Fluffy_Pillow 51.7/100: 52% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:53.827 Waiting 0.600 sec 33.3/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:54.427 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:55.432 Waiting 1.146 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:56.578 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:57.583 healing_touch Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:58.455 Waiting 0.300 sec 46.6/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:58.755 savage_roar Fluffy_Pillow 50.1/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:59.759 rake Fluffy_Pillow 61.7/100: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:00.763 Waiting 0.200 sec 38.2/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
6:00.963 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
6:01.967 Waiting 2.517 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:04.484 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:05.489 Waiting 1.464 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:06.953 lunar_inspiration Fluffy_Pillow 29.6/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
6:07.958 healing_touch Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:08.831 ferocious_bite Fluffy_Pillow 51.3/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:09.835 tigers_fury Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:09.835 berserk Fluffy_Pillow 72.8/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:09.835 use_item_ravaged_seed_pod Fluffy_Pillow 72.8/150: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
6:09.835 potion Fluffy_Pillow 72.8/150: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
6:09.835 rake Fluffy_Pillow 72.8/150: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:10.837 shred Fluffy_Pillow 81.9/150: 55% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:11.843 shred Fluffy_Pillow 88.5/150: 59% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:12.848 shred Fluffy_Pillow 95.1/150: 63% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:13.854 healing_touch Fluffy_Pillow 86.7/150: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:14.725 rip Fluffy_Pillow 96.7/150: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:15.730 shred Fluffy_Pillow 93.3/150: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:16.736 shred Fluffy_Pillow 84.9/150: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:17.739 shred Fluffy_Pillow 76.4/150: 51% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:18.744 healing_touch Fluffy_Pillow 68.0/150: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:19.616 savage_roar Fluffy_Pillow 78.1/150: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:20.620 rake Fluffy_Pillow 69.7/150: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:21.624 lunar_inspiration Fluffy_Pillow 81.2/150: 54% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:22.629 shred Fluffy_Pillow 77.8/150: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:23.634 healing_touch Fluffy_Pillow 69.4/150: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:24.507 ferocious_bite Fluffy_Pillow 79.5/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
6:25.511 shred Fluffy_Pillow 66.0/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:26.515 shred Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:27.519 shred Fluffy_Pillow 49.2/100: 49% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:28.525 Waiting 1.765 sec 20.8/100: 21% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:30.290 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:31.292 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:32.163 Waiting 4.696 sec 22.7/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse, potion_of_the_old_war
6:36.859 ferocious_bite Fluffy_Pillow 76.9/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
6:37.864 rake Fluffy_Pillow 63.5/100: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:38.867 lunar_inspiration Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:39.872 tigers_fury Fluffy_Pillow 21.6/100: 22% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:39.872 shred Fluffy_Pillow 81.6/100: 82% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:40.877 shred Fluffy_Pillow 68.2/100: 68% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:41.882 healing_touch Fluffy_Pillow 54.8/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:42.753 Waiting 0.800 sec 64.8/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
6:43.553 savage_roar Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
6:44.557 rake Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:45.561 Waiting 0.300 sec 37.2/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:45.861 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:46.865 Waiting 1.108 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:47.973 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
6:48.979 lunar_inspiration Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
6:49.984 healing_touch Fluffy_Pillow 48.2/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:50.856 Waiting 2.700 sec 58.2/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:53.556 ferocious_bite Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
6:54.560 ashamanes_frenzy Fluffy_Pillow 75.9/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:55.565 shred Fluffy_Pillow 87.5/100: 88% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:56.569 shred Fluffy_Pillow 59.1/100: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
6:57.573 healing_touch Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:58.443 Waiting 0.700 sec 80.7/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:59.143 ferocious_bite Fluffy_Pillow 88.8/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:00.149 rake Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:01.153 Waiting 1.200 sec 26.9/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:02.353 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:03.358 Waiting 1.596 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:04.954 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:05.958 Waiting 2.498 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:08.456 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:09.462 Waiting 1.064 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:10.526 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:10.526 use_item_ravaged_seed_pod Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:10.526 healing_touch Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:11.397 shadowmeld Fluffy_Pillow 95.0/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
7:11.397 rake Fluffy_Pillow 95.0/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
7:11.397 auto_attack Fluffy_Pillow 60.0/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
7:12.400 Waiting 0.200 sec 86.6/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
7:12.600 savage_roar Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
7:13.605 shred Fluffy_Pillow 86.6/100: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:14.610 shred Fluffy_Pillow 58.2/100: 58% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:15.615 Waiting 0.900 sec 29.8/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:16.515 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:17.519 Waiting 1.253 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:18.772 ferocious_bite Fluffy_Pillow 26.2/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, leeching_pestilence
7:19.776 Waiting 1.664 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, leeching_pestilence
7:21.440 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:24.488 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:25.492 Waiting 1.586 sec 12.5/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:27.078 shred Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
7:28.081 shred Fluffy_Pillow 42.3/100: 42% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:29.085 healing_touch Fluffy_Pillow 13.9/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:29.957 Waiting 0.200 sec 23.9/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 36.08% 36.08% 7027
Haste 15.28% 15.28% 4967
Damage / Heal Versatility 7.65% 7.65% 3058
Attack Power 21649 19943 0
Mastery 56.30% 54.16% 6678
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 847.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Trinket2 Ravaged Seed Pod
ilevel: 865, stats: { +986 Haste }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="arcanocrystal_860 / pod_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=unstable_arcanocrystal,id=141482
trinket2=ravaged_seed_pod,id=139320,bonus_id=1805
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=846.56
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=7027
# gear_haste_rating=3311
# gear_mastery_rating=6678
# gear_versatility_rating=3058
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

baseline : 285648 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
285648.4 285648.4 373.3 / 0.131% 36431.8 / 12.8% 19748.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.5 14.5 Energy 31.28% 42.2 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
baseline 285648
Ashamane's Frenzy 13864 4.9% 6.1 78.68sec 1022361 1017798 Direct 91.3 9514 19023 12740 33.9%  
Periodic 30.2 125847 251654 168167 33.6% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.10 91.27 121.45 30.18 1.0045 0.6473 6238081.56 6784644.40 8.06 73610.89 1017797.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.31 66.08% 9514.06 7081 11329 9515.66 8463 10770 573786 843520 31.98
crit 30.96 33.92% 19023.42 14161 22657 19024.11 16472 20954 588879 865708 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.0 66.36% 125846.79 78070 156132 125863.52 112329 138809 2520566 2520566 0.00
crit 10.2 33.64% 251653.81 156140 312264 251661.20 211968 292315 2554851 2554851 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 33009 11.6% 17.9 23.57sec 830758 0 Periodic 140.0 79373 158625 106138 33.8% 40.0%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.89 0.00 140.02 140.02 0.0000 1.2872 14861895.13 14861895.13 0.00 82457.06 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.7 66.23% 79372.56 55 94573 79281.82 68077 86313 7360615 7360615 0.00
crit 47.3 33.77% 158625.08 110 189146 158494.86 137786 176802 7501280 7501280 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 26703 9.4% 493.4 0.91sec 24350 26770 Direct 493.4 18195 36397 24350 33.8%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 493.37 493.37 0.00 0.00 0.9096 0.0000 12013653.57 17661208.71 31.98 26770.36 26770.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 326.55 66.19% 18195.50 14216 20436 18195.05 17762 18492 5941707 8734872 31.98
crit 166.82 33.81% 36397.07 28433 40872 36397.21 35328 37116 6071947 8926337 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 5666 2.0% 9.9 48.08sec 256777 255636 Direct 9.9 182671 403584 256781 33.6%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.91 9.91 0.00 0.00 1.0045 0.0000 2544342.25 3740424.11 31.98 255635.71 255635.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.58 66.44% 182670.82 14630 251221 182355.64 55080 251221 1202599 1767934 31.98
crit 3.32 33.56% 403584.02 32200 555198 394593.13 0 555198 1341743 1972490 31.22
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 21419 7.5% 31.5 14.37sec 305492 304123 Direct 31.5 32963 65940 44141 33.9%  
Periodic 242.1 25443 50922 34059 33.8% 96.7%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.55 31.55 242.06 242.06 1.0045 1.7973 9636750.12 9636750.12 0.00 20646.54 304123.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.85 66.10% 32963.42 25727 36982 32964.41 30834 34731 687321 687321 0.00
crit 10.69 33.90% 65939.61 51454 73964 65933.77 59493 72759 705164 705164 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 160.2 66.18% 25442.51 134 28764 25441.26 24506 26041 4076039 4076039 0.00
crit 81.9 33.82% 50922.49 268 57529 50920.63 48544 52744 4168226 4168226 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2113 0.7% 23.4 19.03sec 40703 0 Periodic 69.2 13753 0 13753 0.0% 7.6%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.37 0.00 69.16 69.16 0.0000 0.4972 951214.52 1398375.45 31.98 27660.43 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.2 100.00% 13752.83 27 15493 13755.05 12743 14536 951215 1398375 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 10831 3.7% 23.0 17.83sec 209305 0 Direct 23.0 156394 312706 209313 33.9%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.99 22.99 0.00 0.00 0.0000 0.0000 4810918.64 7072506.11 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.20 66.15% 156394.11 122075 175482 156342.31 141912 169760 2377836 3495644 31.98
crit 7.78 33.85% 312705.86 244149 350964 312547.48 244149 350964 2433082 3576862 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 65488 22.9% 46.9 9.62sec 628775 625970 Direct 46.9 81222 162977 108751 33.7%  
Periodic 223.6 81569 163063 109018 33.7% 94.5%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.86 46.86 223.56 223.56 1.0045 1.9031 29466893.83 29466893.83 0.00 62359.05 625969.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.09 66.34% 81222.14 38283 183748 81223.18 67392 93741 2525053 2525053 0.00
crit 15.78 33.66% 162976.66 76565 367495 162938.97 126213 215194 2570871 2570871 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.3 66.32% 81569.12 36 183748 81594.03 72871 89956 12093909 12093909 0.00
crit 75.3 33.68% 163063.43 71 367495 163072.90 137122 193639 12277061 12277061 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 78767 27.6% 22.6 15.85sec 1567114 1560126 Periodic 325.1 81544 163044 109097 33.8% 95.5%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.63 0.00 325.05 325.05 1.0045 1.3224 35461672.95 35461672.95 0.00 78354.31 1560126.39
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 215.2 66.19% 81544.15 55 94573 81529.20 74172 85258 17545436 17545436 0.00
crit 109.9 33.81% 163044.36 127 189146 163033.23 150609 173141 17916237 17916237 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 27789 9.7% 105.7 4.25sec 118169 117640 Direct 105.7 88420 176723 118174 33.7%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.69 105.69 0.00 0.00 1.0045 0.0000 12489120.03 18360189.45 31.98 117639.88 117639.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.08 66.31% 88420.14 61977 133637 88433.94 81642 93374 6196640 9109648 31.98
crit 35.61 33.69% 176722.95 123954 267275 176655.75 157008 193308 6292480 9250541 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
baseline
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.01sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Healing Touch 48.9 9.32sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 48.93 0.00 0.00 0.00 0.8983 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.4 24.96sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.35 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 134.28sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.34sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.12% 10.19% 45.5(45.5) 15.1

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.80% 15.28% 0.0(0.0) 2.9

Buff details

  • buff initial source:baseline
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 48.9 0.0 9.3sec 9.3sec 45.58% 45.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:19.20%
  • bloodtalons_2:26.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 42.1 1.1 10.5sec 10.2sec 5.95% 15.09% 1.1(1.1) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:5.95%

Trigger Attempt Success

  • trigger_pct:8.76%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.9 64.6sec 48.7sec 24.50% 24.58% 1.9(1.9) 6.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.6sec 0.0sec 10.81% 10.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 48.6 1.3 9.2sec 9.0sec 74.45% 74.46% 1.3(1.3) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.45%

Trigger Attempt Success

  • trigger_pct:98.10%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.8 9.5 45.2sec 25.0sec 92.45% 92.19% 201.3(201.3) 7.9

Buff details

  • buff initial source:baseline
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:92.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.9sec 133.9sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.82% 29.25% 0.0(0.0) 15.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
baseline
ferocious_bite Energy 19.8 330.4 16.7 33.3 7701.6
ferocious_bite Combo Points 9.9 44.7 4.5 4.5 56900.8
lunar_inspiration Energy 31.5 783.1 24.8 24.8 12305.3
rake Energy 46.9 1335.2 28.5 28.5 22068.7
rip Energy 22.6 465.5 20.6 20.6 76173.3
rip Combo Points 22.6 113.1 5.0 5.0 313416.6
savage_roar Energy 18.4 478.7 26.1 26.1 0.0
savage_roar Combo Points 18.4 91.8 5.0 5.0 0.0
shred Energy 105.7 3112.5 29.5 29.4 4012.6
Resource Gains Type Count Total Average Overflow
rake Combo Points 46.86 46.86 (18.54%) 1.00 0.00 0.00%
tigers_fury Energy 15.22 912.90 (11.56%) 59.97 0.48 0.05%
ashamanes_frenzy Combo Points 6.10 18.30 (7.24%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.55 31.55 (12.48%) 1.00 0.00 0.00%
shred Combo Points 105.69 105.69 (41.81%) 1.00 0.00 0.00%
energy_regen Energy 1946.57 4881.96 (61.82%) 2.51 59.39 1.20%
clearcasting Energy 42.02 1437.22 (18.20%) 34.20 0.00 0.00%
ashamanes_energy Energy 45.47 664.89 (8.42%) 14.62 17.10 2.51%
primal_fury Combo Points 62.08 50.36 (19.92%) 0.81 11.72 18.88%
Resource RPS-Gain RPS-Loss
Energy 14.35 14.46
Combo Points 0.56 0.55
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 36.02 0.02 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.11 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.7%

Procs

Count Interval
clearcasting 43.2 10.2sec
clearcasting_wasted 1.1 129.8sec
primal_fury 62.1 7.2sec

Statistics & Data Analysis

Fight Length
Sample Data Druid_Feral_T19P Fight Length
Count 2499
Mean 450.05
Minimum 360.07
Maximum 539.96
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Druid_Feral_T19P Damage Per Second
Count 2499
Mean 285648.41
Minimum 248651.33
Maximum 318281.06
Spread ( max - min ) 69629.73
Range [ ( max - min ) / 2 * 100% ] 12.19%
Standard Deviation 9522.1937
5th Percentile 270625.04
95th Percentile 301822.25
( 95th Percentile - 5th Percentile ) 31197.21
Mean Distribution
Standard Deviation 190.4820
95.00% Confidence Intervall ( 285275.07 - 286021.74 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4268
0.1 Scale Factor Error with Delta=300 774029
0.05 Scale Factor Error with Delta=300 3096119
0.01 Scale Factor Error with Delta=300 77402982
Priority Target DPS
Sample Data Druid_Feral_T19P Priority Target Damage Per Second
Count 2499
Mean 285648.41
Minimum 248651.33
Maximum 318281.06
Spread ( max - min ) 69629.73
Range [ ( max - min ) / 2 * 100% ] 12.19%
Standard Deviation 9522.1937
5th Percentile 270625.04
95th Percentile 301822.25
( 95th Percentile - 5th Percentile ) 31197.21
Mean Distribution
Standard Deviation 190.4820
95.00% Confidence Intervall ( 285275.07 - 286021.74 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4268
0.1 Scale Factor Error with Delta=300 774029
0.05 Scale Factor Error with Delta=300 3096119
0.01 Scale Factor Error with Delta=300 77402982
DPS(e)
Sample Data Druid_Feral_T19P Damage Per Second (Effective)
Count 2499
Mean 285648.41
Minimum 248651.33
Maximum 318281.06
Spread ( max - min ) 69629.73
Range [ ( max - min ) / 2 * 100% ] 12.19%
Damage
Sample Data Druid_Feral_T19P Damage
Count 2499
Mean 128474542.59
Minimum 95827853.12
Maximum 163588348.56
Spread ( max - min ) 67760495.45
Range [ ( max - min ) / 2 * 100% ] 26.37%
DTPS
Sample Data Druid_Feral_T19P Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Druid_Feral_T19P Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Druid_Feral_T19P Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Druid_Feral_T19P Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Druid_Feral_T19P Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Druid_Feral_T19P Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Druid_Feral_T19PTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Druid_Feral_T19P Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.55 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.55 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.23 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 4.26 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 47.93 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.84 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.63 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 9.51 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 5.65 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.10 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.55 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.31 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.55 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 105.69 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQCAQIQEMJQQOPELOQQQEJQQQEKOPQQEJCN89QQEJPQQQQEKOOPQEJOCQQQEJOPQQQEIMOEJOCPQQEJQQQEKOPOQEQJPQQCOEJQQQQOEIPOQEJOPQCQQEJN89QEQPQIQQOEOJPQEMCAJQQQQEIOPQQELOQQQEJOPQEKOCQQEJOPQQEJOPQEIOCQPQQEJOQQEJMOEIPOQQELCOQPEJQQQQEKOPOQEJOQCPEJN89QQEIQPOEOJQPCQQEIMODQQPQEKODQPEOQCABLQQQQEJOQPEKQOQQELOPQQECKOQQQPEDOQQPEKMDOCQQQELOPQQEO

Sample Sequence Table

time name target resources buffs
Pre flask baseline 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food baseline 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation baseline 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.004 lunar_inspiration Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.009 shred Fluffy_Pillow 59.9/100: 60% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:03.015 tigers_fury Fluffy_Pillow 33.9/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, potion_of_the_old_war
0:03.015 berserk Fluffy_Pillow 93.9/100: 94% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:03.015 shred Fluffy_Pillow 93.9/150: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:04.020 savage_roar Fluffy_Pillow 102.9/150: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:05.024 shred Fluffy_Pillow 111.9/150: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:06.029 healing_touch Fluffy_Pillow 120.9/150: 81% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:06.785 ashamanes_frenzy Fluffy_Pillow 131.4/150: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:07.789 rip Fluffy_Pillow 145.4/150: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:08.794 shred Fluffy_Pillow 144.3/150: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:09.799 shred Fluffy_Pillow 138.3/150: 92% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:10.804 rake Fluffy_Pillow 132.3/150: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:11.808 lunar_inspiration Fluffy_Pillow 128.8/150: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:12.814 healing_touch Fluffy_Pillow 127.8/150: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:13.569 ferocious_bite Fluffy_Pillow 138.3/150: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
0:14.573 rake Fluffy_Pillow 127.2/150: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:15.578 shred Fluffy_Pillow 123.7/150: 82% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.583 shred Fluffy_Pillow 117.7/150: 78% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.588 shred Fluffy_Pillow 111.7/150: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.593 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:19.347 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, potion_of_the_old_war
0:20.350 shred Fluffy_Pillow 84.0/100: 84% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
0:21.353 shred Fluffy_Pillow 57.9/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.355 Waiting 0.600 sec 31.8/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.955 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.960 healing_touch Fluffy_Pillow 14.2/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:24.715 Waiting 0.400 sec 24.7/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar
0:25.115 savage_roar Fluffy_Pillow 30.2/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar
0:26.119 rake Fluffy_Pillow 44.2/100: 44% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
0:27.122 lunar_inspiration Fluffy_Pillow 58.2/100: 58% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:28.127 shred Fluffy_Pillow 42.1/100: 42% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:29.131 Waiting 1.739 sec 16.1/100: 16% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:30.870 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:31.876 healing_touch Fluffy_Pillow 14.3/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:32.631 rip Fluffy_Pillow 24.8/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar
0:33.634 tigers_fury Fluffy_Pillow 38.7/100: 39% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:33.634 shadowmeld Fluffy_Pillow 98.7/100: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:33.634 rake Fluffy_Pillow 98.7/100: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:33.634 auto_attack Fluffy_Pillow 63.7/100: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.640 shred Fluffy_Pillow 92.7/100: 93% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.646 shred Fluffy_Pillow 81.7/100: 82% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.651 healing_touch Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:37.407 Waiting 0.400 sec 81.2/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:37.807 rip Fluffy_Pillow 86.8/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:38.813 lunar_inspiration Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:39.818 shred Fluffy_Pillow 54.8/100: 55% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:40.822 shred Fluffy_Pillow 68.7/100: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:41.828 Waiting 0.100 sec 39.5/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:41.928 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:42.933 Waiting 2.578 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:45.511 shred Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
0:46.516 healing_touch Fluffy_Pillow 49.7/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:47.455 savage_roar Fluffy_Pillow 59.7/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:48.969 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:49.974 Waiting 2.046 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
0:52.276 rake Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
0:53.280 Waiting 1.710 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:54.990 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:55.995 shred Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
0:56.999 healing_touch Fluffy_Pillow 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:57.938 Waiting 0.800 sec 31.9/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:58.738 rip Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:01.269 rake Fluffy_Pillow 37.5/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:02.275 Waiting 1.193 sec 13.3/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:03.468 tigers_fury Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:03.634 shred Fluffy_Pillow 87.8/100: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:04.639 shred Fluffy_Pillow 73.6/100: 74% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:05.644 shred Fluffy_Pillow 59.3/100: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:06.647 healing_touch Fluffy_Pillow 45.1/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:07.585 Waiting 3.200 sec 55.1/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:10.785 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:11.790 rake Fluffy_Pillow 70.1/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:12.794 lunar_inspiration Fluffy_Pillow 45.9/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
1:13.800 shred Fluffy_Pillow 56.6/100: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:14.806 Waiting 1.200 sec 27.4/100: 27% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:16.006 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:17.012 Waiting 2.809 sec 11.0/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:19.821 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:20.825 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
1:23.550 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
1:24.556 ashamanes_frenzy Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:26.840 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
1:27.844 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:28.782 Waiting 1.886 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:30.668 rip Fluffy_Pillow 42.1/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:32.950 rake Fluffy_Pillow 36.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:33.957 tigers_fury Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:33.957 lunar_inspiration Fluffy_Pillow 72.3/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:34.960 shred Fluffy_Pillow 68.0/100: 68% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.965 shred Fluffy_Pillow 93.8/100: 94% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:36.969 healing_touch Fluffy_Pillow 79.5/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
1:37.907 rip Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
1:38.910 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:39.915 shred Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:40.921 shred Fluffy_Pillow 41.5/100: 42% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
1:41.924 healing_touch Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
1:42.863 savage_roar Fluffy_Pillow 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:44.122 rake Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:45.125 Waiting 1.761 sec 11.5/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:46.886 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:47.890 Waiting 1.299 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:49.189 rake Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
1:50.192 Waiting 0.400 sec 35.7/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:50.592 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:51.594 Waiting 1.833 sec 10.7/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:53.427 healing_touch Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:54.365 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
1:55.370 Waiting 2.895 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
1:58.265 rip Fluffy_Pillow 42.1/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar
1:59.270 lunar_inspiration Fluffy_Pillow 52.9/100: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar
2:00.274 shred Fluffy_Pillow 63.6/100: 64% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:01.279 Waiting 0.600 sec 34.4/100: 34% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:01.879 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:03.903 tigers_fury Fluffy_Pillow 22.4/100: 22% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
2:03.957 rake Fluffy_Pillow 83.0/100: 83% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:04.962 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:05.900 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:06.904 shred Fluffy_Pillow 95.7/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:07.907 shred Fluffy_Pillow 81.5/100: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
2:08.911 shred Fluffy_Pillow 52.2/100: 52% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:09.917 Waiting 1.688 sec 23.0/100: 23% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
2:11.605 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
2:12.609 Waiting 1.434 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
2:14.809 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
2:15.814 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
2:16.751 savage_roar Fluffy_Pillow 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
2:17.754 lunar_inspiration Fluffy_Pillow 31.8/100: 32% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:21.059 rake Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:22.064 Waiting 1.524 sec 13.0/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:23.588 shred Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
2:24.591 healing_touch Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:25.531 Waiting 1.300 sec 50.1/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:26.831 rip Fluffy_Pillow 64.0/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:27.835 rake Fluffy_Pillow 44.7/100: 45% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
2:28.839 lunar_inspiration Fluffy_Pillow 55.5/100: 55% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:29.843 Waiting 0.400 sec 36.2/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:30.243 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:31.248 Waiting 2.485 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:33.733 tigers_fury Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:33.957 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:34.961 shred Fluffy_Pillow 85.7/100: 86% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:35.965 healing_touch Fluffy_Pillow 71.5/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:36.904 Waiting 0.100 sec 81.5/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:37.004 rip Fluffy_Pillow 97.6/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:38.009 shadowmeld Fluffy_Pillow 78.4/100: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:38.009 rake Fluffy_Pillow 78.4/100: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:38.009 auto_attack Fluffy_Pillow 78.4/100: 78% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
2:39.011 shred Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
2:40.014 healing_touch Fluffy_Pillow 59.8/100: 60% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:40.951 shred Fluffy_Pillow 69.8/100: 70% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), tigers_fury
2:41.954 lunar_inspiration Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, tigers_fury
2:42.959 Waiting 0.743 sec 21.3/100: 21% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons
2:43.702 shred Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons
2:44.707 savage_roar Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting
2:45.711 shred Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:46.715 Waiting 1.825 sec 21.5/100: 22% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:48.540 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:49.544 Waiting 1.434 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:51.744 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:52.749 Waiting 2.500 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:55.249 healing_touch Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:56.187 rake Fluffy_Pillow 47.9/100: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
2:57.190 Waiting 0.730 sec 23.6/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
2:57.920 rip Fluffy_Pillow 31.4/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar
2:58.926 lunar_inspiration Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:59.930 Waiting 1.693 sec 22.9/100: 23% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:01.623 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:02.627 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:03.564 ashamanes_frenzy Fluffy_Pillow 21.8/100: 22% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar
3:04.570 tigers_fury Fluffy_Pillow 32.6/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
3:04.570 berserk Fluffy_Pillow 92.6/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
3:04.570 rip Fluffy_Pillow 92.6/150: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury
3:05.577 shred Fluffy_Pillow 103.4/150: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:06.582 shred Fluffy_Pillow 109.1/150: 73% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:07.586 shred Fluffy_Pillow 114.9/150: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:08.591 shred Fluffy_Pillow 105.6/150: 70% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:09.594 healing_touch Fluffy_Pillow 96.3/150: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, tigers_fury
3:10.533 savage_roar Fluffy_Pillow 106.4/150: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, tigers_fury
3:11.538 rake Fluffy_Pillow 117.1/150: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury
3:12.542 lunar_inspiration Fluffy_Pillow 110.4/150: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury
3:13.545 shred Fluffy_Pillow 106.1/150: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:14.550 shred Fluffy_Pillow 96.9/150: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar
3:15.554 healing_touch Fluffy_Pillow 87.6/150: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:16.492 ferocious_bite Fluffy_Pillow 97.7/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:17.497 rake Fluffy_Pillow 83.4/150: 56% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:18.500 shred Fluffy_Pillow 76.6/150: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar
3:19.505 shred Fluffy_Pillow 67.4/150: 45% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar
3:20.508 shred Fluffy_Pillow 58.1/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
3:21.513 healing_touch Fluffy_Pillow 68.9/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:22.452 Waiting 1.000 sec 78.9/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:23.452 rip Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:24.456 rake Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:25.461 lunar_inspiration Fluffy_Pillow 46.1/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
3:26.466 shred Fluffy_Pillow 56.9/100: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:27.471 healing_touch Fluffy_Pillow 27.6/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:28.410 Waiting 3.200 sec 37.7/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:31.610 savage_roar Fluffy_Pillow 71.9/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:32.615 rake Fluffy_Pillow 42.7/100: 43% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
3:33.620 Waiting 0.713 sec 18.4/100: 18% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:34.333 tigers_fury Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:34.570 shred Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:35.574 shred Fluffy_Pillow 74.3/100: 74% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:36.578 healing_touch Fluffy_Pillow 60.1/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:37.517 Waiting 0.400 sec 70.1/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
3:37.917 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
3:38.923 rake Fluffy_Pillow 70.2/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:39.925 lunar_inspiration Fluffy_Pillow 45.9/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:40.930 Waiting 1.300 sec 26.7/100: 27% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:42.230 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:43.235 Waiting 2.778 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:46.013 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:47.018 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:47.955 Waiting 2.596 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:50.551 rip Fluffy_Pillow 49.6/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:52.065 rake Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:53.068 Waiting 1.258 sec 11.5/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:54.326 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
3:55.331 Waiting 0.400 sec 35.8/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:55.731 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:56.735 healing_touch Fluffy_Pillow 10.8/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:57.674 Waiting 0.890 sec 20.8/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:59.583 savage_roar Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
4:02.889 rake Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:03.895 Waiting 1.178 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:05.073 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:05.073 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:06.077 lunar_inspiration Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:07.081 shred Fluffy_Pillow 66.5/100: 66% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:08.086 shred Fluffy_Pillow 52.2/100: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:09.092 healing_touch Fluffy_Pillow 23.0/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:10.030 Waiting 1.500 sec 33.0/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:11.530 rip Fluffy_Pillow 49.1/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:12.535 rake Fluffy_Pillow 29.8/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:13.539 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:14.543 Waiting 1.277 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:15.820 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
4:16.824 healing_touch Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:17.765 Waiting 3.800 sec 45.8/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:21.565 rip Fluffy_Pillow 86.5/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:22.570 ashamanes_frenzy Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:23.574 rake Fluffy_Pillow 78.0/100: 78% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:24.578 healing_touch Fluffy_Pillow 53.7/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:25.516 savage_roar Fluffy_Pillow 63.7/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
4:26.521 lunar_inspiration Fluffy_Pillow 34.5/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
4:27.525 rake Fluffy_Pillow 45.2/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
4:28.530 shred Fluffy_Pillow 56.0/100: 56% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
4:29.535 Waiting 1.300 sec 26.8/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:30.835 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:31.838 healing_touch Fluffy_Pillow 11.4/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:32.776 Waiting 1.133 sec 21.4/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:33.909 ferocious_bite Fluffy_Pillow 33.6/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:34.915 tigers_fury Fluffy_Pillow 19.3/100: 19% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:35.073 rake Fluffy_Pillow 81.0/100: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:36.079 shred Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:37.084 lunar_inspiration Fluffy_Pillow 57.5/100: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:38.089 healing_touch Fluffy_Pillow 53.3/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:39.028 rip Fluffy_Pillow 63.3/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
4:40.032 shred Fluffy_Pillow 74.1/100: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:41.037 shred Fluffy_Pillow 44.8/100: 45% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
4:42.041 shred Fluffy_Pillow 15.6/100: 16% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
4:43.044 Waiting 0.200 sec 26.3/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:43.244 shred Fluffy_Pillow 28.5/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
4:44.248 healing_touch Fluffy_Pillow 39.2/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:45.186 Waiting 1.500 sec 49.2/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:46.686 savage_roar Fluffy_Pillow 65.3/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:47.690 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:48.693 Waiting 1.737 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:50.430 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:53.734 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:54.738 shred Fluffy_Pillow 11.4/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
4:55.744 healing_touch Fluffy_Pillow 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:56.683 Waiting 1.900 sec 32.3/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:58.583 rip Fluffy_Pillow 52.6/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:59.588 Waiting 0.300 sec 33.3/100: 33% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:59.888 rake Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:00.894 Waiting 2.685 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:03.579 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:04.585 Waiting 1.232 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:05.817 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:05.817 lunar_inspiration Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:06.820 healing_touch Fluffy_Pillow 80.7/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:07.759 rip Fluffy_Pillow 90.8/100: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:08.766 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:08.766 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:08.766 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:09.771 shred Fluffy_Pillow 90.8/100: 91% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
5:10.777 shred Fluffy_Pillow 61.5/100: 62% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:11.780 healing_touch Fluffy_Pillow 32.3/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:12.720 Waiting 0.800 sec 42.3/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:13.520 savage_roar Fluffy_Pillow 50.9/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
5:14.526 Waiting 1.814 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:16.340 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:17.345 Waiting 1.733 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:19.078 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:20.082 Waiting 1.800 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
5:22.394 rake Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
5:23.399 Waiting 1.253 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:24.652 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:25.592 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
5:26.597 Waiting 1.326 sec 10.8/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:27.923 rip Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar
5:28.929 Waiting 0.400 sec 35.8/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:29.329 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:30.332 Waiting 2.029 sec 10.8/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:32.361 lunar_inspiration Fluffy_Pillow 32.5/100: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:33.365 Waiting 2.300 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:35.665 tigers_fury Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:35.817 shred Fluffy_Pillow 99.5/100: 99% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:36.820 shred Fluffy_Pillow 85.2/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:37.826 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, jacins_ruse
5:38.764 savage_roar Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, jacins_ruse
5:39.770 ashamanes_frenzy Fluffy_Pillow 85.8/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:40.777 rake Fluffy_Pillow 96.5/100: 97% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:41.781 ferocious_bite Fluffy_Pillow 72.3/100: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:42.786 shred Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:43.791 Waiting 1.100 sec 28.8/100: 29% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:44.891 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:45.895 Waiting 1.779 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:47.674 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:48.679 shred Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
5:49.683 healing_touch Fluffy_Pillow 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:50.621 Waiting 1.700 sec 31.9/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:52.321 savage_roar Fluffy_Pillow 50.1/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:54.858 rake Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:55.865 Waiting 2.022 sec 13.0/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:57.887 ferocious_bite Fluffy_Pillow 34.6/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:58.892 Waiting 1.331 sec 10.8/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
6:00.223 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar
6:01.227 lunar_inspiration Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:02.231 Waiting 0.795 sec 16.5/100: 16% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:03.026 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
6:03.966 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons(2), savage_roar
6:04.970 shred Fluffy_Pillow 45.8/100: 46% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar
6:05.974 tigers_fury Fluffy_Pillow 16.5/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points savage_roar
6:05.974 berserk Fluffy_Pillow 76.5/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, savage_roar, tigers_fury
6:05.974 potion Fluffy_Pillow 76.5/150: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, savage_roar, tigers_fury
6:05.974 ferocious_bite Fluffy_Pillow 76.5/150: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:06.978 shred Fluffy_Pillow 77.3/150: 52% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:07.982 shred Fluffy_Pillow 83.0/150: 55% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:08.985 shred Fluffy_Pillow 88.8/150: 59% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:09.990 shred Fluffy_Pillow 79.5/150: 53% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:10.994 healing_touch Fluffy_Pillow 70.3/150: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:11.929 rip Fluffy_Pillow 80.3/150: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:12.933 rake Fluffy_Pillow 76.0/150: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:13.938 shred Fluffy_Pillow 69.3/150: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:14.941 lunar_inspiration Fluffy_Pillow 60.0/150: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:15.946 healing_touch Fluffy_Pillow 55.7/150: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:16.885 savage_roar Fluffy_Pillow 65.8/150: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:17.889 shred Fluffy_Pillow 56.5/150: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:18.893 rake Fluffy_Pillow 47.3/150: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:19.898 shred Fluffy_Pillow 40.5/150: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:20.904 shred Fluffy_Pillow 31.3/150: 21% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:21.907 healing_touch Fluffy_Pillow 22.0/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:22.844 Waiting 5.400 sec 32.1/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:28.244 ferocious_bite Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:29.248 rake Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:30.253 Waiting 0.400 sec 26.3/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:30.653 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:31.658 shred Fluffy_Pillow 11.4/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
6:32.663 Waiting 1.768 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:34.431 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:35.435 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:36.374 tigers_fury Fluffy_Pillow 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:36.374 Waiting 0.700 sec 81.8/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:37.074 savage_roar Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:38.078 rake Fluffy_Pillow 75.1/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:39.082 shred Fluffy_Pillow 65.8/100: 66% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:40.086 shred Fluffy_Pillow 91.6/100: 92% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
6:41.090 shred Fluffy_Pillow 62.3/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
6:42.094 Waiting 0.300 sec 33.0/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
6:42.394 lunar_inspiration Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
6:43.399 healing_touch Fluffy_Pillow 17.0/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
6:44.337 Waiting 1.600 sec 27.0/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
6:45.937 ferocious_bite Fluffy_Pillow 44.2/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:46.941 rake Fluffy_Pillow 10.7/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
6:47.945 Waiting 1.828 sec 21.5/100: 21% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:49.773 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:50.776 Waiting 2.735 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:53.511 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:54.514 Waiting 1.835 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:56.349 lunar_inspiration Fluffy_Pillow 31.4/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:57.352 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:58.290 Waiting 1.763 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:00.053 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:01.058 ashamanes_frenzy Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:02.318 ferocious_bite Fluffy_Pillow 25.3/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
7:05.625 rake Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:06.628 tigers_fury Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:06.628 shred Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:07.632 shred Fluffy_Pillow 56.9/100: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:08.638 shred Fluffy_Pillow 42.6/100: 43% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:09.642 healing_touch Fluffy_Pillow 28.4/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
7:10.579 Waiting 4.800 sec 38.4/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
7:15.379 ferocious_bite Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:16.386 rake Fluffy_Pillow 50.5/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:17.391 lunar_inspiration Fluffy_Pillow 26.3/100: 26% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
7:18.396 Waiting 0.300 sec 37.0/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:18.696 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:19.700 Waiting 2.808 sec 11.0/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:22.508 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:23.512 Waiting 2.434 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:25.946 healing_touch Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:26.885 rake Fluffy_Pillow 47.9/100: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
7:27.890 Waiting 2.227 sec 23.6/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 33.77% 33.77% 6220
Haste 7.01% 7.01% 2277
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 21649 19943 0
Mastery 51.70% 49.54% 5871
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 844.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="baseline"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=844.29
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=6220
# gear_haste_rating=1518
# gear_mastery_rating=5871
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

call_865 / pod_865 : 310310 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
310309.8 310309.8 385.6 / 0.124% 39096.5 / 12.6% 20513.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.1 15.1 Energy 30.28% 44.8 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
call_865 / pod_865 310310
Ashamane's Frenzy 14387 4.6% 6.1 78.38sec 1058668 1054021 Direct 91.5 9715 19439 13173 35.6%  
Periodic 30.2 128547 257023 174260 35.6% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.11 91.46 121.69 30.23 1.0045 0.6471 6472744.90 7039116.73 8.05 76249.51 1054021.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.94 64.44% 9715.43 7168 12497 9718.72 8697 10924 572590 841762 31.98
crit 32.52 35.56% 19439.44 14337 24995 19442.45 17379 21842 632213 929413 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.5 64.41% 128547.48 81013 172240 128599.44 113969 143884 2502819 2502819 0.00
crit 10.8 35.59% 257022.75 158074 344480 256976.72 223243 303303 2765122 2765122 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 36608 11.8% 19.0 22.39sec 868981 0 Periodic 149.5 81536 162915 110301 35.4% 42.9%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.97 0.00 149.46 149.46 0.0000 1.2903 16485942.24 16485942.24 0.00 85484.50 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.6 64.65% 81535.92 56 104331 81455.21 73630 89573 7878415 7878415 0.00
crit 52.8 35.35% 162914.77 112 208661 162762.01 142268 184267 8607527 8607527 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 28945 9.3% 526.6 0.85sec 24728 29000 Direct 526.6 18260 36515 24727 35.4%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 526.63 526.63 0.00 0.00 0.8527 0.0000 13022334.96 19144065.89 31.98 28999.68 28999.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 340.05 64.57% 18260.18 14216 20436 18259.86 17883 18533 6209364 9128353 31.98
crit 186.58 35.43% 36514.56 28433 40872 36513.47 35476 37285 6812971 10015713 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6930 2.2% 11.2 42.02sec 278952 277720 Direct 11.2 195135 432003 278926 35.4%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.17 11.17 0.00 0.00 1.0045 0.0000 3115462.15 4580024.47 31.98 277719.93 277719.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.22 64.62% 195134.89 15013 251221 194900.33 88945 243029 1408282 2070308 31.98
crit 3.95 35.38% 432003.12 33627 555198 427081.02 0 555198 1707180 2509717 31.63
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Infested Ground 5335 1.7% 7.9 60.70sec 305674 0 Direct 77.6 22863 45719 30917 35.2%  

Stats details: infested_ground

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.85 77.63 0.00 0.00 0.0000 0.0000 2399888.59 2399888.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.27 64.77% 22863.43 16725 24042 22864.68 21608 23508 1149435 1149435 0.00
crit 27.35 35.23% 45719.04 33450 48085 45722.09 42719 47583 1250454 1250454 0.00
 
 

Action details: infested_ground

Static Values
  • id:221803
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221803
  • name:Infested Ground
  • school:shadow
  • tooltip:
  • description:Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.
 
Moonfire (lunar_inspiration) 23075 7.4% 31.7 14.32sec 328018 326553 Direct 31.7 33049 66096 44680 35.2%  
Periodic 259.2 25542 51083 34597 35.5% 97.0%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.65 31.65 259.21 259.21 1.0045 1.6845 10382105.70 10382105.70 0.00 22163.43 326553.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.51 64.80% 33049.33 25727 36982 33048.03 31045 35259 677873 677873 0.00
crit 11.14 35.20% 66095.82 51454 73964 66087.45 60029 71553 736315 736315 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 167.3 64.55% 25542.49 63 28764 25542.12 24814 26102 4273790 4273790 0.00
crit 91.9 35.45% 51082.53 226 57529 51084.06 48889 52684 4694128 4694128 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2272 0.7% 25.1 17.85sec 40762 0 Periodic 74.1 13790 0 13790 0.0% 8.2%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.08 0.00 74.14 74.14 0.0000 0.4970 1022465.46 1503121.07 31.98 27745.94 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.1 100.00% 13790.24 27 15493 13793.06 12852 14535 1022465 1503121 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11663 3.7% 24.4 16.65sec 212014 0 Direct 24.4 156767 313667 212001 35.2%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.43 24.43 0.00 0.00 0.0000 0.0000 5179287.33 7614042.97 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.83 64.79% 156767.45 122075 175482 156752.58 144377 169240 2481124 3647487 31.98
crit 8.60 35.21% 313666.64 244149 350964 313494.25 0 350964 2698163 3966556 31.96
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 68689 22.1% 47.5 9.49sec 650323 647408 Direct 47.5 83397 167197 112969 35.3%  
Periodic 223.9 84239 168525 114070 35.4% 95.2%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.53 47.53 223.86 223.86 1.0045 1.9135 30906602.93 30906602.93 0.00 64915.52 647407.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.75 64.71% 83397.22 38757 202706 83404.68 70782 94765 2564676 2564676 0.00
crit 16.77 35.29% 167196.91 77514 405411 167246.73 135232 216308 2804432 2804432 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 144.6 64.60% 84239.29 40 202706 84262.03 75246 92650 12182286 12182286 0.00
crit 79.2 35.40% 168524.70 72 405411 168555.82 139976 197067 13355208 13355208 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 82487 26.6% 23.0 15.33sec 1611073 1603865 Periodic 327.4 83790 167494 113416 35.4% 96.5%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.05 0.00 327.40 327.40 1.0045 1.3259 37132677.39 37132677.39 0.00 81208.17 1603864.78
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 211.5 64.61% 83790.07 62 104331 83784.13 79364 87636 17723923 17723923 0.00
crit 115.9 35.39% 167493.53 143 208661 167483.46 155393 176880 19408754 19408754 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 29919 9.6% 112.1 4.01sec 119937 119399 Direct 112.1 88632 177225 119942 35.3%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.13 112.13 0.00 0.00 1.0045 0.0000 13448317.63 19770300.78 31.98 119399.44 119399.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.51 64.66% 88632.17 61977 133637 88647.03 83931 94070 6426358 9447356 31.98
crit 39.62 35.34% 177225.14 123954 267275 177137.88 162124 194476 7021959 10322945 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
call_865 / pod_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:call_865 / pod_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.08sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Cleansed Drake's Breath 4.3 77.54sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.28 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:call_865 / pod_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:call_865 / pod_865
  • harmful:false
  • if_expr:
 
Healing Touch 51.4 8.87sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 51.41 0.00 0.00 0.00 0.8490 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.7 24.50sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.72 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.10sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.35sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.10% 10.18% 45.4(45.4) 15.1

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.1sec 182.1sec 9.78% 14.66% 0.0(0.0) 2.9

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.23% 0.0(0.0) 1.0

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 51.4 0.0 8.8sec 8.9sec 46.00% 46.04% 0.0(0.0) 0.0

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.57%
  • bloodtalons_2:27.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Cleansed Ancient's Blessing 3.9 0.3 87.7sec 79.3sec 8.93% 9.03% 0.3(0.3) 3.8

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_ancients_blessing_1:8.93%

Trigger Attempt Success

  • trigger_pct:98.48%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 3.9 0.3 87.8sec 79.1sec 8.97% 9.07% 0.3(0.3) 3.8

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_sisters_blessing_1:8.97%

Trigger Attempt Success

  • trigger_pct:98.83%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 4.0 0.3 86.8sec 78.3sec 9.09% 9.19% 0.3(0.3) 3.9

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_wisps_blessing_1:9.09%

Trigger Attempt Success

  • trigger_pct:99.04%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Clearcasting 44.7 1.5 9.9sec 9.6sec 6.64% 15.36% 1.5(1.5) 0.0

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.64%

Trigger Attempt Success

  • trigger_pct:8.78%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.7 1.8 63.7sec 48.4sec 24.69% 24.77% 1.8(1.8) 6.4

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Leeching Pestilence 7.9 0.0 60.7sec 60.7sec 17.28% 17.36% 0.0(0.0) 7.7

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_leeching_pestilence
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:leech_rating
  • amount:1771.29

Stack Uptimes

  • leeching_pestilence_1:17.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221805
  • name:Leeching Pestilence
  • tooltip:Leech increased by $w1.
  • description:{$@spelldesc221803=Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.5sec 0.0sec 10.81% 10.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 51.1 1.1 8.8sec 8.6sec 74.41% 74.42% 1.1(1.1) 0.0

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.41%

Trigger Attempt Success

  • trigger_pct:98.65%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 7.7 11.0 50.5sec 24.5sec 94.00% 93.73% 202.0(202.0) 6.7

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:94.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.2sec 133.2sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.80% 28.95% 0.0(0.0) 14.9

Buff details

  • buff initial source:call_865 / pod_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
call_865 / pod_865
ferocious_bite Energy 22.3 381.8 17.1 34.2 8158.9
ferocious_bite Combo Points 11.2 52.3 4.7 4.7 59596.7
lunar_inspiration Energy 31.7 783.8 24.8 24.8 13245.0
rake Energy 47.5 1350.9 28.4 28.4 22878.5
rip Energy 23.0 467.1 20.3 20.3 79491.4
rip Combo Points 23.0 115.2 5.0 5.0 322204.2
savage_roar Energy 18.7 481.4 25.7 25.7 0.0
savage_roar Combo Points 18.7 93.6 5.0 5.0 0.0
shred Energy 112.1 3338.5 29.8 29.8 4028.3
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.52 47.52 (17.98%) 1.00 0.00 0.00%
tigers_fury Energy 15.20 911.44 (10.99%) 59.97 0.50 0.06%
ashamanes_frenzy Combo Points 6.11 18.34 (6.94%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.65 31.65 (11.97%) 1.00 0.00 0.00%
shred Combo Points 112.13 112.13 (42.42%) 1.00 0.00 0.00%
energy_regen Energy 2097.31 5197.26 (62.67%) 2.48 76.95 1.46%
clearcasting Energy 44.62 1522.90 (18.36%) 34.13 0.00 0.00%
ashamanes_energy Energy 45.42 661.12 (7.97%) 14.56 20.15 2.96%
primal_fury Combo Points 67.54 54.71 (20.70%) 0.81 12.83 18.99%
Resource RPS-Gain RPS-Loss
Energy 15.04 15.12
Combo Points 0.59 0.58
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 36.65 0.18 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.22 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.9%

Procs

Count Interval
clearcasting 46.2 9.6sec
clearcasting_wasted 1.5 119.7sec
primal_fury 67.5 6.6sec

Statistics & Data Analysis

Fight Length
Sample Data call_865 / pod_865 Fight Length
Count 2499
Mean 450.05
Minimum 360.07
Maximum 539.96
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data call_865 / pod_865 Damage Per Second
Count 2499
Mean 310309.79
Minimum 269649.77
Maximum 340343.77
Spread ( max - min ) 70694.00
Range [ ( max - min ) / 2 * 100% ] 11.39%
Standard Deviation 9834.5629
5th Percentile 294526.34
95th Percentile 327099.47
( 95th Percentile - 5th Percentile ) 32573.12
Mean Distribution
Standard Deviation 196.7306
95.00% Confidence Intervall ( 309924.20 - 310695.37 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3858
0.1 Scale Factor Error with Delta=300 825645
0.05 Scale Factor Error with Delta=300 3302583
0.01 Scale Factor Error with Delta=300 82564582
Priority Target DPS
Sample Data call_865 / pod_865 Priority Target Damage Per Second
Count 2499
Mean 310309.79
Minimum 269649.77
Maximum 340343.77
Spread ( max - min ) 70694.00
Range [ ( max - min ) / 2 * 100% ] 11.39%
Standard Deviation 9834.5629
5th Percentile 294526.34
95th Percentile 327099.47
( 95th Percentile - 5th Percentile ) 32573.12
Mean Distribution
Standard Deviation 196.7306
95.00% Confidence Intervall ( 309924.20 - 310695.37 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3858
0.1 Scale Factor Error with Delta=300 825645
0.05 Scale Factor Error with Delta=300 3302583
0.01 Scale Factor Error with Delta=300 82564582
DPS(e)
Sample Data call_865 / pod_865 Damage Per Second (Effective)
Count 2499
Mean 310309.79
Minimum 269649.77
Maximum 340343.77
Spread ( max - min ) 70694.00
Range [ ( max - min ) / 2 * 100% ] 11.39%
Damage
Sample Data call_865 / pod_865 Damage
Count 2499
Mean 139567829.28
Minimum 101515801.10
Maximum 174243399.17
Spread ( max - min ) 72727598.07
Range [ ( max - min ) / 2 * 100% ] 26.05%
DTPS
Sample Data call_865 / pod_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data call_865 / pod_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data call_865 / pod_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data call_865 / pod_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data call_865 / pod_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data call_865 / pod_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data call_865 / pod_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data call_865 / pod_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.58 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.58 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 7.85 use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
C 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
D 15.20 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
E 3.77 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
F 50.41 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
J 7.72 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
K 23.05 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
L 11.01 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
M 7.39 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
N 6.11 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
O 3.58 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
P 42.95 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
Q 31.65 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
R 112.13 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789QRDABJRRFNKRRPFMQPRRFKRRRRFLPQRFDKO89RRRQFLRRPRRFKPQRFMPDBRRRFKPQRRFRJNPQFKPDRRRRFKPQRRFJPQRRFDBKPRRRQFKPRQFJPRRDRFKO89QRRFKNPFLPQRFMPRDABRQFKPRRRFLRPRRFKQRRFMPRRDQFKPRRRFJPRQRRFKPRRFLNPDBQFKRRRRFMPQRRFKPQDRRRFJO89RRQFKRPRFPKDBQRRRFJPQNFKPRRFLPQPRDFKRRRRQFLPERRQRFMPRRDABCRFLPQRFMRRRFMPRRFMPQFNLPRDRQFMO89RRRFMRQPFLPRRFDBMPQRRFMPRQFLRR

Sample Sequence Table

time name target resources buffs
Pre flask call_865 / pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food call_865 / pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation call_865 / pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, potion_of_the_old_war
0:01.004 lunar_inspiration Fluffy_Pillow 76.8/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.009 shred Fluffy_Pillow 61.5/100: 62% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:03.012 tigers_fury Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, potion_of_the_old_war
0:03.012 berserk Fluffy_Pillow 96.3/100: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:03.012 use_item_ravaged_seed_pod Fluffy_Pillow 96.3/150: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:03.012 savage_roar Fluffy_Pillow 96.3/150: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:04.018 shred Fluffy_Pillow 106.1/150: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:05.023 shred Fluffy_Pillow 115.8/150: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:06.026 healing_touch Fluffy_Pillow 125.6/150: 84% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:06.783 ashamanes_frenzy Fluffy_Pillow 136.7/150: 91% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:07.788 rip Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons, berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:08.791 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:09.795 shred Fluffy_Pillow 144.8/150: 97% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:10.799 rake Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:11.804 healing_touch Fluffy_Pillow 147.3/150: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
0:12.559 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, leeching_pestilence, potion_of_the_old_war
0:13.564 lunar_inspiration Fluffy_Pillow 139.8/150: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:14.569 rake Fluffy_Pillow 139.5/150: 93% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:15.573 shred Fluffy_Pillow 136.8/150: 91% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.578 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.585 healing_touch Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing, potion_of_the_old_war
0:18.339 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, cleansed_sisters_blessing, potion_of_the_old_war
0:19.343 shred Fluffy_Pillow 86.4/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, potion_of_the_old_war
0:20.348 shred Fluffy_Pillow 62.8/100: 63% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing, potion_of_the_old_war
0:21.353 Waiting 0.100 sec 39.2/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing, potion_of_the_old_war
0:21.453 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing, potion_of_the_old_war
0:22.456 Waiting 1.475 sec 17.2/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing, potion_of_the_old_war
0:23.931 shred Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing
0:24.934 healing_touch Fluffy_Pillow 17.7/100: 18% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing
0:25.688 Waiting 0.700 sec 30.0/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, cleansed_sisters_blessing
0:26.388 savage_roar Fluffy_Pillow 41.5/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, cleansed_sisters_blessing
0:28.672 rake Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:29.678 lunar_inspiration Fluffy_Pillow 15.2/100: 15% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, bloodtalons, predatory_swiftness, savage_roar
0:30.683 Waiting 0.700 sec 30.0/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:31.383 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:32.386 healing_touch Fluffy_Pillow 15.0/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_wisps_blessing
0:33.139 tigers_fury Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, cleansed_wisps_blessing
0:33.139 rip Fluffy_Pillow 86.1/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_wisps_blessing
0:34.143 shadowmeld Fluffy_Pillow 85.8/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:34.143 rake Fluffy_Pillow 85.8/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:34.143 auto_attack Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:35.148 shred Fluffy_Pillow 80.6/100: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:36.152 shred Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:37.156 shred Fluffy_Pillow 45.1/100: 45% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:38.160 Waiting 1.349 sec 19.9/100: 20% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:39.509 lunar_inspiration Fluffy_Pillow 39.7/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:40.514 healing_touch Fluffy_Pillow 24.5/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
0:41.351 Waiting 0.200 sec 35.4/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_wisps_blessing
0:41.551 savage_roar Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:42.555 shred Fluffy_Pillow 49.0/100: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:43.560 Waiting 1.809 sec 20.4/100: 20% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
0:45.369 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
0:46.375 Waiting 1.132 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:48.529 rake Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:49.533 Waiting 1.069 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:50.602 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
0:51.607 Waiting 0.400 sec 36.4/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:52.007 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:53.010 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:53.900 Waiting 0.739 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:54.639 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:55.644 rake Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
0:56.648 lunar_inspiration Fluffy_Pillow 23.4/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
0:57.651 Waiting 0.100 sec 34.7/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:57.751 shred Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
0:58.756 healing_touch Fluffy_Pillow 47.2/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:59.645 Waiting 0.500 sec 57.3/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
1:00.145 ferocious_bite Fluffy_Pillow 62.9/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
1:01.152 Waiting 0.500 sec 24.3/100: 24% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:02.162 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:03.166 tigers_fury Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
1:03.166 use_item_ravaged_seed_pod Fluffy_Pillow 72.1/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
1:03.166 shred Fluffy_Pillow 72.1/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, leeching_pestilence
1:04.170 shred Fluffy_Pillow 58.4/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, leeching_pestilence
1:05.173 shred Fluffy_Pillow 44.8/100: 45% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, leeching_pestilence
1:06.177 healing_touch Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, leeching_pestilence
1:07.066 Waiting 3.700 sec 41.2/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_ancients_blessing, leeching_pestilence
1:10.766 rip Fluffy_Pillow 83.0/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_wisps_blessing, leeching_pestilence
1:11.770 rake Fluffy_Pillow 64.4/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing, leeching_pestilence
1:12.776 lunar_inspiration Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, cleansed_wisps_blessing, leeching_pestilence
1:13.781 Waiting 1.656 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, cleansed_wisps_blessing
1:15.437 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, cleansed_wisps_blessing
1:16.443 Waiting 2.532 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, cleansed_wisps_blessing
1:18.975 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
1:19.979 Waiting 1.333 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:21.312 healing_touch Fluffy_Pillow 27.3/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:22.201 shred Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons(2)
1:23.204 savage_roar Fluffy_Pillow 48.6/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons
1:24.209 ashamanes_frenzy Fluffy_Pillow 20.0/100: 20% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:25.726 rake Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:26.731 Waiting 1.014 sec 13.5/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:27.745 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
1:28.751 healing_touch Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:29.641 rip Fluffy_Pillow 46.4/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:31.413 rake Fluffy_Pillow 36.5/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:32.419 Waiting 1.074 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:33.493 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:33.493 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:34.497 shred Fluffy_Pillow 71.3/100: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.503 shred Fluffy_Pillow 57.7/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:36.507 shred Fluffy_Pillow 44.1/100: 44% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
1:37.510 healing_touch Fluffy_Pillow 15.4/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:38.398 Waiting 4.600 sec 25.5/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:42.998 rip Fluffy_Pillow 77.5/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:44.001 rake Fluffy_Pillow 58.8/100: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:45.006 lunar_inspiration Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:46.012 Waiting 2.146 sec 16.6/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:48.158 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, jacins_ruse
1:49.163 Waiting 2.533 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, jacins_ruse
1:51.696 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, jacins_ruse
1:52.701 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, jacins_ruse
1:55.376 savage_roar Fluffy_Pillow 42.4/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), jacins_ruse
1:56.379 rake Fluffy_Pillow 53.8/100: 54% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
1:57.383 lunar_inspiration Fluffy_Pillow 30.1/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:58.389 shred Fluffy_Pillow 41.5/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:59.393 Waiting 2.273 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:01.666 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:02.672 healing_touch Fluffy_Pillow 13.8/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
2:03.472 tigers_fury Fluffy_Pillow 23.8/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse
2:03.493 use_item_ravaged_seed_pod Fluffy_Pillow 84.1/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
2:03.493 rip Fluffy_Pillow 84.1/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_sisters_blessing, leeching_pestilence, jacins_ruse
2:04.498 rake Fluffy_Pillow 81.7/100: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, leeching_pestilence
2:05.501 shred Fluffy_Pillow 74.3/100: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, leeching_pestilence
2:06.506 shred Fluffy_Pillow 61.9/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, leeching_pestilence
2:07.510 Waiting 0.500 sec 34.5/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, leeching_pestilence
2:08.010 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, leeching_pestilence
2:09.015 Waiting 1.418 sec 13.5/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, leeching_pestilence
2:10.433 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:11.437 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:12.326 Waiting 2.695 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, leeching_pestilence
2:15.021 rip Fluffy_Pillow 52.1/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:16.282 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:17.285 Waiting 2.484 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:19.769 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
2:20.773 Waiting 2.033 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
2:22.806 lunar_inspiration Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, cleansed_wisps_blessing
2:23.810 healing_touch Fluffy_Pillow 16.5/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, cleansed_wisps_blessing
2:25.974 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), cleansed_wisps_blessing
2:26.977 rake Fluffy_Pillow 52.3/100: 52% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_wisps_blessing
2:27.982 Waiting 1.000 sec 28.7/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing
2:28.982 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
2:29.987 Waiting 2.142 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
2:32.129 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:33.135 Waiting 0.978 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:34.113 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
2:34.113 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
2:35.118 healing_touch Fluffy_Pillow 72.6/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
2:35.919 rip Fluffy_Pillow 82.7/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
2:36.923 shadowmeld Fluffy_Pillow 80.3/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
2:36.923 rake Fluffy_Pillow 80.3/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
2:36.923 auto_attack Fluffy_Pillow 45.3/100: 45% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
2:37.927 lunar_inspiration Fluffy_Pillow 72.9/100: 73% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, cleansed_wisps_blessing
2:38.932 shred Fluffy_Pillow 85.1/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
2:39.936 shred Fluffy_Pillow 56.4/100: 56% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
2:40.941 healing_touch Fluffy_Pillow 27.8/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
2:41.828 Waiting 3.800 sec 37.8/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
2:45.628 rip Fluffy_Pillow 80.8/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:46.634 ashamanes_frenzy Fluffy_Pillow 62.2/100: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:47.639 rake Fluffy_Pillow 73.5/100: 74% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:48.644 healing_touch Fluffy_Pillow 49.9/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:49.533 Waiting 0.300 sec 59.9/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
2:49.833 savage_roar Fluffy_Pillow 63.3/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
2:50.837 rake Fluffy_Pillow 74.7/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
2:51.842 lunar_inspiration Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:52.846 shred Fluffy_Pillow 32.4/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:53.852 healing_touch Fluffy_Pillow 43.8/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:54.738 Waiting 3.100 sec 53.8/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:57.838 ferocious_bite Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:58.842 rake Fluffy_Pillow 50.2/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:59.846 Waiting 1.200 sec 26.6/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:01.046 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:02.051 Waiting 1.894 sec 11.5/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:03.945 tigers_fury Fluffy_Pillow 32.9/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:04.113 berserk Fluffy_Pillow 94.8/100: 95% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:04.113 use_item_ravaged_seed_pod Fluffy_Pillow 94.8/150: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:04.113 shred Fluffy_Pillow 94.8/150: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:05.118 lunar_inspiration Fluffy_Pillow 101.2/150: 67% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:06.122 healing_touch Fluffy_Pillow 112.5/150: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:07.011 rip Fluffy_Pillow 122.6/150: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:08.014 rake Fluffy_Pillow 133.9/150: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:09.018 shred Fluffy_Pillow 127.8/150: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
3:10.022 shred Fluffy_Pillow 119.1/150: 79% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:11.027 shred Fluffy_Pillow 110.5/150: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:12.031 healing_touch Fluffy_Pillow 101.8/150: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:12.921 savage_roar Fluffy_Pillow 111.9/150: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, leeching_pestilence
3:13.924 shred Fluffy_Pillow 103.2/150: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), berserk, predatory_swiftness, savage_roar, leeching_pestilence
3:14.929 rake Fluffy_Pillow 114.6/150: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar
3:15.935 shred Fluffy_Pillow 126.0/150: 84% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar
3:16.940 shred Fluffy_Pillow 117.4/150: 78% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:17.945 healing_touch Fluffy_Pillow 108.7/150: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:18.834 rip Fluffy_Pillow 118.8/150: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:19.838 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
3:20.842 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:21.846 shred Fluffy_Pillow 71.4/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:22.850 healing_touch Fluffy_Pillow 42.7/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:23.740 Waiting 3.200 sec 52.8/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:26.940 ferocious_bite Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:27.944 rake Fluffy_Pillow 75.3/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:28.949 shred Fluffy_Pillow 51.7/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:29.956 Waiting 1.571 sec 23.1/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:31.527 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:32.534 Waiting 1.331 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:33.865 tigers_fury Fluffy_Pillow 27.3/100: 27% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:34.113 lunar_inspiration Fluffy_Pillow 90.1/100: 90% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:35.116 healing_touch Fluffy_Pillow 86.4/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:36.004 rip Fluffy_Pillow 96.4/100: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
3:37.008 rake Fluffy_Pillow 92.8/100: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:38.014 shred Fluffy_Pillow 84.2/100: 84% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, tigers_fury
3:39.020 shred Fluffy_Pillow 95.6/100: 96% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
3:40.024 shred Fluffy_Pillow 66.9/100: 67% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
3:41.030 healing_touch Fluffy_Pillow 38.3/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
3:41.919 savage_roar Fluffy_Pillow 48.3/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
3:44.458 rake Fluffy_Pillow 37.0/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:45.463 shred Fluffy_Pillow 14.6/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:46.467 Waiting 0.400 sec 27.2/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:46.867 lunar_inspiration Fluffy_Pillow 32.3/100: 32% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:47.872 Waiting 1.704 sec 14.9/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:49.576 shred Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:50.580 shred Fluffy_Pillow 48.9/100: 49% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:51.584 healing_touch Fluffy_Pillow 61.5/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:52.385 Waiting 1.300 sec 71.6/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
3:53.685 rip Fluffy_Pillow 87.9/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
3:54.688 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:55.691 shred Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:56.695 shred Fluffy_Pillow 18.0/100: 18% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
3:57.698 healing_touch Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:58.587 Waiting 2.600 sec 39.4/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:01.187 savage_roar Fluffy_Pillow 68.8/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:02.189 ashamanes_frenzy Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:03.193 rake Fluffy_Pillow 51.4/100: 51% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
4:04.199 tigers_fury Fluffy_Pillow 27.8/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:04.199 use_item_ravaged_seed_pod Fluffy_Pillow 87.8/100: 88% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:04.199 lunar_inspiration Fluffy_Pillow 87.8/100: 88% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:05.205 healing_touch Fluffy_Pillow 84.2/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:06.091 rip Fluffy_Pillow 94.2/100: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
4:07.095 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:08.100 shred Fluffy_Pillow 86.4/100: 86% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:09.103 shred Fluffy_Pillow 57.7/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:10.107 shred Fluffy_Pillow 29.1/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:11.112 healing_touch Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:12.001 Waiting 3.400 sec 50.5/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
4:15.401 ferocious_bite Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:16.407 rake Fluffy_Pillow 50.3/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:17.412 Waiting 0.300 sec 26.8/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:17.712 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:18.716 Waiting 2.142 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:20.858 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:21.864 Waiting 2.178 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:24.042 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:25.047 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:25.847 Waiting 0.578 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
4:26.425 rip Fluffy_Pillow 30.0/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
4:29.474 rake Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:30.478 Waiting 1.652 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, cleansed_ancients_blessing
4:32.130 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, cleansed_ancients_blessing
4:33.134 Waiting 1.149 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, cleansed_ancients_blessing
4:34.283 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, cleansed_ancients_blessing
4:34.283 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, cleansed_ancients_blessing
4:35.287 shred Fluffy_Pillow 71.3/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, cleansed_ancients_blessing
4:36.291 shred Fluffy_Pillow 57.7/100: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury, cleansed_ancients_blessing
4:37.296 healing_touch Fluffy_Pillow 84.1/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, cleansed_ancients_blessing
4:38.185 savage_roar Fluffy_Pillow 94.1/100: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, cleansed_ancients_blessing
4:39.190 shadowmeld Fluffy_Pillow 65.5/100: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:39.190 rake Fluffy_Pillow 65.5/100: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:39.190 auto_attack Fluffy_Pillow 65.5/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:40.193 shred Fluffy_Pillow 76.8/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:41.199 shred Fluffy_Pillow 48.2/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:42.203 Waiting 0.982 sec 19.5/100: 20% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:43.185 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:44.190 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:45.077 Waiting 0.761 sec 22.0/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:45.838 rip Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:46.843 Waiting 2.548 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:49.391 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:52.433 rake Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:53.438 Waiting 2.585 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:56.023 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:57.028 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:59.194 rake Fluffy_Pillow 36.7/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar
5:00.198 Waiting 1.558 sec 13.0/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:01.756 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:02.762 Waiting 1.347 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness
5:04.109 tigers_fury Fluffy_Pillow 27.3/100: 27% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, jacins_ruse
5:04.283 use_item_ravaged_seed_pod Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, jacins_ruse
5:04.283 lunar_inspiration Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, leeching_pestilence, jacins_ruse
5:05.289 shred Fluffy_Pillow 85.6/100: 86% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, leeching_pestilence, jacins_ruse
5:06.295 shred Fluffy_Pillow 72.0/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, leeching_pestilence, jacins_ruse
5:07.300 shred Fluffy_Pillow 58.3/100: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury, leeching_pestilence, jacins_ruse
5:08.305 healing_touch Fluffy_Pillow 29.7/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, leeching_pestilence, jacins_ruse
5:09.450 savage_roar Fluffy_Pillow 42.6/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, leeching_pestilence, jacins_ruse
5:12.502 rake Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
5:13.505 Waiting 1.516 sec 13.5/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
5:15.021 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:17.048 ashamanes_frenzy Fluffy_Pillow 23.6/100: 24% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:18.194 healing_touch Fluffy_Pillow 36.5/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:19.083 rip Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:20.087 rake Fluffy_Pillow 27.9/100: 28% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:21.094 Waiting 0.100 sec 39.3/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:21.194 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:22.198 Waiting 2.567 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:24.765 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:25.769 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:26.658 savage_roar Fluffy_Pillow 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:27.918 rake Fluffy_Pillow 36.5/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:28.924 Waiting 1.574 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:30.498 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:31.504 Waiting 2.547 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:34.051 rake Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:35.056 shred Fluffy_Pillow 52.2/100: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:36.062 tigers_fury Fluffy_Pillow 23.6/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:36.062 healing_touch Fluffy_Pillow 83.6/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:36.949 rip Fluffy_Pillow 93.6/100: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:37.955 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:38.961 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:39.965 shred Fluffy_Pillow 86.4/100: 86% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
5:40.968 shred Fluffy_Pillow 57.7/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:41.973 Waiting 0.200 sec 29.1/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:42.173 lunar_inspiration Fluffy_Pillow 31.3/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:43.176 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:44.063 Waiting 2.904 sec 22.7/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:46.967 savage_roar Fluffy_Pillow 55.5/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing
5:48.736 rake Fluffy_Pillow 35.5/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_wisps_blessing
5:49.740 Waiting 1.046 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
5:50.786 ferocious_bite Fluffy_Pillow 26.3/100: 26% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
5:51.791 Waiting 1.984 sec 12.6/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
5:53.775 shred Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_sisters_blessing, cleansed_wisps_blessing
5:54.778 shred Fluffy_Pillow 50.2/100: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
5:55.783 Waiting 0.576 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
5:56.359 lunar_inspiration Fluffy_Pillow 30.0/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
5:57.363 shred Fluffy_Pillow 12.6/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_sisters_blessing
5:58.366 healing_touch Fluffy_Pillow 25.2/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
5:59.206 Waiting 3.900 sec 35.2/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:03.106 ferocious_bite Fluffy_Pillow 79.3/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
6:04.110 rake Fluffy_Pillow 65.7/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:05.115 shred Fluffy_Pillow 42.0/100: 42% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
6:06.118 shred Fluffy_Pillow 53.4/100: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:07.121 tigers_fury Fluffy_Pillow 24.7/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:07.121 berserk Fluffy_Pillow 84.7/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:07.121 use_item_ravaged_seed_pod Fluffy_Pillow 84.7/150: 56% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
6:07.121 potion Fluffy_Pillow 84.7/150: 56% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
6:07.121 shred Fluffy_Pillow 84.7/150: 56% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:08.125 healing_touch Fluffy_Pillow 91.1/150: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:09.013 savage_roar Fluffy_Pillow 101.1/150: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:10.017 rake Fluffy_Pillow 107.5/150: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:11.022 lunar_inspiration Fluffy_Pillow 116.3/150: 78% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:12.027 shred Fluffy_Pillow 112.7/150: 75% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:13.032 healing_touch Fluffy_Pillow 104.1/150: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:13.921 ferocious_bite Fluffy_Pillow 114.1/150: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:14.925 shred Fluffy_Pillow 100.5/150: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:15.929 shred Fluffy_Pillow 91.8/150: 61% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
6:16.934 shred Fluffy_Pillow 83.2/150: 55% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
6:17.938 healing_touch Fluffy_Pillow 74.5/150: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:18.826 ferocious_bite Fluffy_Pillow 84.6/150: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:19.828 rake Fluffy_Pillow 83.4/150: 56% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:20.832 shred Fluffy_Pillow 77.3/150: 52% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:21.838 shred Fluffy_Pillow 68.6/150: 46% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:22.842 healing_touch Fluffy_Pillow 60.0/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:23.731 Waiting 1.700 sec 70.0/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:25.431 ferocious_bite Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:26.436 rake Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:27.441 Waiting 0.300 sec 27.0/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:27.741 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:28.745 Waiting 2.572 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse, potion_of_the_old_war
6:31.317 healing_touch Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:32.205 ashamanes_frenzy Fluffy_Pillow 50.9/100: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
6:33.211 savage_roar Fluffy_Pillow 62.2/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar, jacins_ruse
6:34.215 rake Fluffy_Pillow 73.6/100: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:35.219 shred Fluffy_Pillow 50.0/100: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:36.223 Waiting 0.726 sec 21.3/100: 21% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:36.949 tigers_fury Fluffy_Pillow 29.5/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:37.121 shred Fluffy_Pillow 91.5/100: 91% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:38.126 lunar_inspiration Fluffy_Pillow 77.8/100: 78% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:39.130 healing_touch Fluffy_Pillow 74.2/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:40.017 Waiting 0.200 sec 84.2/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:40.217 ferocious_bite Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
6:41.222 shadowmeld Fluffy_Pillow 61.4/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
6:41.222 rake Fluffy_Pillow 61.4/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
6:41.222 auto_attack Fluffy_Pillow 61.4/100: 61% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
6:42.225 shred Fluffy_Pillow 72.7/100: 73% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
6:43.229 shred Fluffy_Pillow 44.1/100: 44% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
6:44.234 Waiting 1.446 sec 15.4/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
6:45.680 shred Fluffy_Pillow 31.8/100: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
6:46.683 healing_touch Fluffy_Pillow 43.1/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
6:47.572 Waiting 3.200 sec 53.2/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
6:50.772 ferocious_bite Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
6:51.776 shred Fluffy_Pillow 75.7/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:52.782 lunar_inspiration Fluffy_Pillow 47.1/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:53.786 Waiting 0.500 sec 28.4/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:54.539 rake Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:55.544 healing_touch Fluffy_Pillow 13.3/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:56.433 Waiting 0.244 sec 23.4/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
6:56.677 savage_roar Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
6:57.682 rake Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:58.688 Waiting 2.384 sec 13.9/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:01.072 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:02.077 Waiting 2.533 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
7:04.610 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
7:05.616 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
7:06.505 Waiting 0.442 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
7:06.947 tigers_fury Fluffy_Pillow 27.3/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
7:07.121 use_item_ravaged_seed_pod Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_ancients_blessing
7:07.121 ferocious_bite Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_ancients_blessing, leeching_pestilence
7:08.128 rake Fluffy_Pillow 65.6/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, leeching_pestilence
7:09.135 lunar_inspiration Fluffy_Pillow 57.0/100: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, leeching_pestilence
7:10.141 shred Fluffy_Pillow 53.4/100: 53% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, leeching_pestilence
7:11.146 Waiting 0.200 sec 24.7/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, leeching_pestilence
7:11.346 shred Fluffy_Pillow 27.0/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, leeching_pestilence
7:12.350 healing_touch Fluffy_Pillow 38.4/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:13.239 Waiting 3.600 sec 48.4/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
7:16.839 ferocious_bite Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, leeching_pestilence
7:17.842 rake Fluffy_Pillow 50.5/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:18.846 Waiting 1.200 sec 26.8/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:20.046 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:21.051 lunar_inspiration Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
7:22.056 healing_touch Fluffy_Pillow 23.1/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:22.945 Waiting 3.000 sec 33.2/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:25.945 savage_roar Fluffy_Pillow 67.1/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
7:26.950 shred Fluffy_Pillow 78.4/100: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:27.955 shred Fluffy_Pillow 49.8/100: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:28.961 Waiting 1.137 sec 21.2/100: 21% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 34.71% 34.71% 6549
Haste 13.08% 13.08% 4250
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 21649 19943 0
Mastery 53.58% 51.42% 6200
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 847.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Nature's Call
ilevel: 865, stats: { +329 Mastery, +329 Haste, +329 Crit }
Local Trinket2 Ravaged Seed Pod
ilevel: 865, stats: { +986 Haste }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="call_865 / pod_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=natures_call,id=139334,bonus_id=1805
trinket2=ravaged_seed_pod,id=139320,bonus_id=1805
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=846.88
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=6549
# gear_haste_rating=2833
# gear_mastery_rating=6200
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

instinct_865 / appendages_865 : 326305 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
326304.8 326304.8 419.2 / 0.128% 43328.7 / 13.3% 21810.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.0 15.0 Energy 30.48% 43.3 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
instinct_865 / appendages_865 326305
Ashamane's Frenzy 15378 4.7% 6.1 78.53sec 1132754 1127701 Direct 91.3 10540 21070 14092 33.7%  
Periodic 30.2 139390 278875 186380 33.7% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.11 91.33 121.53 30.20 1.0045 0.6473 6916191.89 7521193.38 8.04 81557.90 1127701.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.52 66.27% 10539.72 7848 12511 10543.48 9598 11659 637892 937761 31.98
crit 30.81 33.73% 21070.18 15696 25021 21072.96 18767 23381 649086 954218 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.0 66.30% 139389.87 86529 172422 139428.15 124716 156749 2791220 2791220 0.00
crit 10.2 33.70% 278874.68 173058 344844 278866.33 233900 319591 2837994 2837994 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 38147 11.7% 18.6 22.97sec 920313 0 Periodic 145.4 88219 176426 118006 33.8% 41.7%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.65 0.00 145.44 145.44 0.0000 1.2891 17162971.28 17162971.28 0.00 91542.68 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.3 66.23% 88218.76 61 104442 88107.79 79610 98430 8498145 8498145 0.00
crit 49.1 33.77% 176425.69 122 208884 176230.75 149576 192321 8664826 8664826 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 29429 9.0% 518.1 0.87sec 25555 29575 Direct 518.1 19105 38208 25555 33.8%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 518.05 518.05 0.00 0.00 0.8641 0.0000 13238844.71 19462355.74 31.98 29575.22 29575.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 343.14 66.24% 19105.00 14889 21403 19104.72 18686 19394 6555607 9637363 31.98
crit 174.92 33.76% 38207.72 29778 42805 38206.30 37197 39057 6683238 9824993 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6901 2.1% 10.7 43.82sec 289233 287942 Direct 10.7 204610 452273 289254 34.2%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.73 10.73 0.00 0.00 1.0045 0.0000 3102283.91 4560651.20 31.98 287941.70 287941.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.06 65.82% 204610.25 15625 268499 203740.90 24841 259744 1444449 2123477 31.98
crit 3.67 34.18% 452273.38 35829 593384 444760.90 0 593384 1657835 2437175 31.48
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Horrific Slam 7091 2.2% 101.0 3.49sec 31606 0 Direct 101.0 23611 47216 31606 33.9%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.99 100.99 0.00 0.00 0.0000 0.0000 3191779.65 3191779.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.79 66.13% 23611.26 18381 26423 23615.59 21408 25438 1576952 1576952 0.00
crit 34.20 33.87% 47216.29 36763 52846 47212.28 41358 51123 1614828 1614828 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16532.30
  • base_dd_max:18272.54
 
Moonfire (lunar_inspiration) 23987 7.4% 31.7 14.32sec 340816 339293 Direct 31.7 35281 70599 47224 33.8%  
Periodic 255.9 27176 54330 36332 33.7% 97.0%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.66 31.66 255.87 255.87 1.0045 1.7062 10791539.45 10791539.45 0.00 23040.24 339292.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.96 66.19% 35281.06 27496 39526 35280.98 33048 36948 739364 739364 0.00
crit 10.71 33.81% 70599.15 54992 79051 70581.84 61866 77333 755906 755906 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 169.6 66.28% 27175.73 86 30743 27175.47 26207 27882 4608993 4608993 0.00
crit 86.3 33.72% 54329.91 57 61485 54330.00 51520 56651 4687277 4687277 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2223 0.7% 24.6 18.22sec 40696 0 Periodic 72.6 13772 0 13772 0.0% 8.0%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.58 0.00 72.63 72.63 0.0000 0.4969 1000298.12 1470532.99 31.98 27718.30 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.6 100.00% 13771.82 54 15493 13775.17 12978 14552 1000298 1470533 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11372 3.4% 24.1 16.97sec 209830 0 Direct 24.1 156588 313255 209822 34.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.06 24.06 0.00 0.00 0.0000 0.0000 5047926.54 7420930.16 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.88 66.01% 156588.05 122075 175482 156579.98 138231 169760 2486657 3655622 31.98
crit 8.18 33.99% 313254.69 244149 350964 313161.08 244149 350964 2561269 3765308 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 73246 22.5% 47.3 9.54sec 697126 694015 Direct 47.3 90368 180668 120926 33.8%  
Periodic 223.7 91008 182039 121765 33.8% 94.9%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.27 47.27 223.69 223.69 1.0045 1.9101 32954624.51 32954624.51 0.00 69413.67 694015.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.27 66.15% 90368.15 42431 202922 90368.09 76563 105097 2825804 2825804 0.00
crit 16.00 33.85% 180667.71 84863 405843 180624.72 144445 240918 2890933 2890933 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.1 66.21% 91008.43 40 202922 91037.66 81172 103123 13479296 13479296 0.00
crit 75.6 33.79% 182039.43 79 405843 182078.63 153526 211395 13758593 13758593 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 87933 27.0% 22.9 15.49sec 1731964 1724235 Periodic 326.4 90655 181293 121269 33.8% 96.1%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.86 0.00 326.44 326.44 1.0045 1.3245 39588432.11 39588432.11 0.00 86944.29 1724234.85
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 216.2 66.22% 90654.82 61 104442 90640.48 82475 94248 19597601 19597601 0.00
crit 110.3 33.78% 181293.05 141 208884 181269.70 164633 190767 19990831 19990831 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 30599 9.4% 110.8 4.06sec 124122 123567 Direct 110.8 92744 185256 124121 33.9%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.82 110.82 0.00 0.00 1.0045 0.0000 13754819.65 20220887.78 31.98 123566.63 123566.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.23 66.08% 92743.81 64908 139959 92755.81 86604 97836 6791630 9984339 31.98
crit 37.59 33.92% 185255.63 129817 279918 185198.47 167085 206014 6963190 10236549 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
instinct_865 / appendages_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_865 / appendages_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 181.99sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_865 / appendages_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_865 / appendages_865
  • harmful:false
  • if_expr:
 
Healing Touch 50.5 9.03sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.46 0.00 0.00 0.00 0.8612 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.6 24.70sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.60 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 132.84sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.34sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.19% 45.5(45.5) 15.1

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 14.82% 0.0(0.0) 2.9

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Blood Frenzy 14.6 7.9 30.7sec 19.5sec 40.46% 40.51% 7.9(7.9) 14.1

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2902.15

Stack Uptimes

  • blood_frenzy_1:40.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 8.22% 0.0(0.0) 1.0

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 50.4 0.0 9.0sec 9.0sec 45.62% 45.66% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.78%
  • bloodtalons_2:26.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 44.0 1.4 10.1sec 9.7sec 6.41% 15.27% 1.4(1.4) 0.0

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.41%

Trigger Attempt Success

  • trigger_pct:8.76%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Horrific Appendages 5.7 1.0 71.9sec 59.1sec 17.04% 17.13% 102.0(102.0) 5.6

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:17.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Jacin's Ruse 6.6 1.9 64.2sec 48.5sec 24.64% 24.73% 1.9(1.9) 6.4

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.3sec 0.0sec 10.81% 10.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 50.2 1.2 8.9sec 8.7sec 74.65% 74.66% 1.2(1.2) 0.0

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.65%

Trigger Attempt Success

  • trigger_pct:98.50%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.1 10.5 48.1sec 24.7sec 93.49% 93.25% 201.9(201.9) 7.1

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.3sec 133.3sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.81% 29.10% 0.0(0.0) 14.9

Buff details

  • buff initial source:instinct_865 / appendages_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
instinct_865 / appendages_865
ferocious_bite Energy 21.5 364.0 17.0 33.9 8521.9
ferocious_bite Combo Points 10.7 49.7 4.6 4.6 62400.8
lunar_inspiration Energy 31.7 784.5 24.8 24.8 13755.4
rake Energy 47.3 1345.3 28.5 28.5 24496.4
rip Energy 22.9 463.9 20.3 20.3 85335.6
rip Combo Points 22.9 114.3 5.0 5.0 346402.2
savage_roar Energy 18.6 481.5 25.9 25.9 0.0
savage_roar Combo Points 18.6 93.0 5.0 5.0 0.0
shred Energy 110.8 3289.2 29.7 29.7 4181.8
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.27 47.27 (18.17%) 1.00 0.00 0.00%
tigers_fury Energy 15.22 912.38 (11.14%) 59.96 0.54 0.06%
ashamanes_frenzy Combo Points 6.11 18.32 (7.04%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.66 31.66 (12.17%) 1.00 0.00 0.00%
shred Combo Points 110.82 110.82 (42.59%) 1.00 0.00 0.00%
energy_regen Energy 2105.34 5115.86 (62.47%) 2.43 76.40 1.47%
clearcasting Energy 43.91 1500.12 (18.32%) 34.17 0.00 0.00%
ashamanes_energy Energy 45.45 661.35 (8.08%) 14.55 20.47 3.00%
primal_fury Combo Points 64.29 52.13 (20.04%) 0.81 12.16 18.91%
Resource RPS-Gain RPS-Loss
Energy 14.86 14.95
Combo Points 0.58 0.57
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 37.07 0.03 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.17 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.9%

Procs

Count Interval
clearcasting 45.4 9.7sec
clearcasting_wasted 1.4 119.4sec
primal_fury 64.3 7.0sec

Statistics & Data Analysis

Fight Length
Sample Data instinct_865 / appendages_865 Fight Length
Count 2499
Mean 450.05
Minimum 360.07
Maximum 539.96
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data instinct_865 / appendages_865 Damage Per Second
Count 2499
Mean 326304.83
Minimum 289323.30
Maximum 367150.75
Spread ( max - min ) 77827.45
Range [ ( max - min ) / 2 * 100% ] 11.93%
Standard Deviation 10691.0130
5th Percentile 308875.27
95th Percentile 344380.86
( 95th Percentile - 5th Percentile ) 35505.59
Mean Distribution
Standard Deviation 213.8630
95.00% Confidence Intervall ( 325885.67 - 326724.00 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4123
0.1 Scale Factor Error with Delta=300 975711
0.05 Scale Factor Error with Delta=300 3902845
0.01 Scale Factor Error with Delta=300 97571141
Priority Target DPS
Sample Data instinct_865 / appendages_865 Priority Target Damage Per Second
Count 2499
Mean 326304.83
Minimum 289323.30
Maximum 367150.75
Spread ( max - min ) 77827.45
Range [ ( max - min ) / 2 * 100% ] 11.93%
Standard Deviation 10691.0130
5th Percentile 308875.27
95th Percentile 344380.86
( 95th Percentile - 5th Percentile ) 35505.59
Mean Distribution
Standard Deviation 213.8630
95.00% Confidence Intervall ( 325885.67 - 326724.00 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4123
0.1 Scale Factor Error with Delta=300 975711
0.05 Scale Factor Error with Delta=300 3902845
0.01 Scale Factor Error with Delta=300 97571141
DPS(e)
Sample Data instinct_865 / appendages_865 Damage Per Second (Effective)
Count 2499
Mean 326304.83
Minimum 289323.30
Maximum 367150.75
Spread ( max - min ) 77827.45
Range [ ( max - min ) / 2 * 100% ] 11.93%
Damage
Sample Data instinct_865 / appendages_865 Damage
Count 2499
Mean 146749711.82
Minimum 106337824.82
Maximum 182813965.50
Spread ( max - min ) 76476140.68
Range [ ( max - min ) / 2 * 100% ] 26.06%
DTPS
Sample Data instinct_865 / appendages_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data instinct_865 / appendages_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data instinct_865 / appendages_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data instinct_865 / appendages_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data instinct_865 / appendages_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data instinct_865 / appendages_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data instinct_865 / appendages_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data instinct_865 / appendages_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.56 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.56 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.22 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 3.89 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 49.46 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.10 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.86 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 10.50 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 6.83 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.11 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.56 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.71 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.66 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 110.82 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQQIQCAQQEJMOPELOQQEJQQQQQEKOPOQCEN89JQPQEKQQOPEJOQQEJCOQPQEIOQQPEOJQQECMJPQOQEIOQPEJOQQQQEKOPCQQEJQQQELOPQEKOQQEJCOPQQQEJOQPQEQIMOPEJOCAQQEJN89QQQEKPQQQELQQOEJOPQCEJOQQPEIOQQEOJPCQQQEIOQEMJPQQEKOPOQQEJCOQQQEJOPQQEKOPOQEJCOQQQEJOPQEIOQQPEJMQCOEJN89QPQEKQQQOEDOPQQECABKOQPQELQQQQELOQQEKOPQQQECDOPQELOQQQEKMOPELOQQECLOPQEKOQQQPE

Sample Sequence Table

time name target resources buffs
Pre flask instinct_865 / appendages_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food instinct_865 / appendages_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation instinct_865 / appendages_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, blood_frenzy, potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 77.7/100: 78% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, bloodtalons, blood_frenzy, potion_of_the_old_war
0:02.009 shred Fluffy_Pillow 93.4/100: 93% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, blood_frenzy, potion_of_the_old_war
0:03.015 shred Fluffy_Pillow 69.2/100: 69% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, blood_frenzy, potion_of_the_old_war
0:04.018 savage_roar Fluffy_Pillow 84.9/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, blood_frenzy, potion_of_the_old_war
0:05.023 shred Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:06.028 tigers_fury Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:06.028 berserk Fluffy_Pillow 96.4/100: 96% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:06.028 shred Fluffy_Pillow 96.4/150: 64% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:07.032 shred Fluffy_Pillow 127.1/150: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:08.036 healing_touch Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:08.790 rip Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:09.796 ashamanes_frenzy Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:10.800 rake Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:11.805 lunar_inspiration Fluffy_Pillow 148.2/150: 99% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:12.810 healing_touch Fluffy_Pillow 149.0/150: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:13.630 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:14.637 rake Fluffy_Pillow 139.0/150: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:15.642 shred Fluffy_Pillow 135.5/150: 90% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.647 shred Fluffy_Pillow 129.5/150: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.651 healing_touch Fluffy_Pillow 123.4/150: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.405 rip Fluffy_Pillow 133.9/150: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
0:19.411 shred Fluffy_Pillow 132.9/150: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.416 shred Fluffy_Pillow 146.9/150: 98% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:21.422 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.426 shred Fluffy_Pillow 74.0/100: 74% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.430 shred Fluffy_Pillow 47.9/100: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.434 healing_touch Fluffy_Pillow 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:25.190 Waiting 1.100 sec 32.4/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:26.290 savage_roar Fluffy_Pillow 47.7/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:28.317 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:29.320 Waiting 1.128 sec 14.9/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:30.448 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:32.985 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:33.989 Waiting 1.832 sec 14.8/100: 15% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:35.821 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:36.825 tigers_fury Fluffy_Pillow 14.3/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:36.825 healing_touch Fluffy_Pillow 74.3/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:37.581 shadowmeld Fluffy_Pillow 84.8/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:37.581 rake Fluffy_Pillow 84.8/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, shadowmeld, clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:37.581 auto_attack Fluffy_Pillow 84.8/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, ashamanes_energy, savage_roar, tigers_fury
0:38.586 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, ashamanes_energy, savage_roar, tigers_fury
0:39.590 shred Fluffy_Pillow 99.0/100: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:40.593 lunar_inspiration Fluffy_Pillow 87.9/100: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:41.598 shred Fluffy_Pillow 69.2/100: 69% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:42.602 healing_touch Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:43.437 Waiting 3.100 sec 51.3/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
0:46.537 savage_roar Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
0:47.542 shred Fluffy_Pillow 60.7/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
0:48.545 Waiting 0.600 sec 32.8/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:49.145 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:50.150 Waiting 1.067 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:52.239 rake Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:53.243 Waiting 1.281 sec 14.4/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:54.524 lunar_inspiration Fluffy_Pillow 29.8/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
0:55.527 healing_touch Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:56.466 rip Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:57.470 rake Fluffy_Pillow 31.4/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
0:58.476 shred Fluffy_Pillow 42.1/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:59.481 Waiting 2.633 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:02.114 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:03.121 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:04.061 Waiting 0.791 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:04.852 rip Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:06.627 tigers_fury Fluffy_Pillow 19.3/100: 19% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:06.825 rake Fluffy_Pillow 81.5/100: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:07.828 shred Fluffy_Pillow 72.2/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:08.832 lunar_inspiration Fluffy_Pillow 57.9/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:09.837 shred Fluffy_Pillow 53.7/100: 54% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
1:10.842 healing_touch Fluffy_Pillow 25.8/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:11.675 Waiting 4.400 sec 35.8/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, horrific_appendages, blood_frenzy
1:16.075 savage_roar Fluffy_Pillow 88.8/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), horrific_appendages, blood_frenzy
1:17.080 rake Fluffy_Pillow 60.9/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
1:18.087 Waiting 0.200 sec 38.0/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
1:18.287 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
1:19.290 Waiting 2.537 sec 12.5/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
1:21.827 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
1:22.831 Waiting 1.796 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
1:24.627 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:25.631 Waiting 1.300 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:26.931 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:27.868 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons(2), savage_roar
1:28.871 rip Fluffy_Pillow 45.8/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
1:29.875 Waiting 1.300 sec 26.5/100: 27% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
1:31.175 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
1:32.179 Waiting 2.793 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:34.972 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:35.977 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:36.836 tigers_fury Fluffy_Pillow 21.8/100: 22% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:36.836 ashamanes_frenzy Fluffy_Pillow 81.8/100: 82% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
1:37.841 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
1:38.846 lunar_inspiration Fluffy_Pillow 97.1/100: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:39.849 shred Fluffy_Pillow 94.2/100: 94% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:40.854 rake Fluffy_Pillow 66.3/100: 66% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, tigers_fury, blood_frenzy
1:41.859 shred Fluffy_Pillow 78.4/100: 78% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury, blood_frenzy
1:42.864 healing_touch Fluffy_Pillow 50.5/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury, blood_frenzy
1:43.701 savage_roar Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, blood_frenzy
1:44.963 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
1:45.968 Waiting 2.509 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
1:48.477 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:49.483 Waiting 1.828 sec 10.8/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:51.311 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:52.315 healing_touch Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:53.149 Waiting 2.656 sec 23.1/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:55.805 rip Fluffy_Pillow 55.1/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages, blood_frenzy
1:56.811 rake Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
1:57.817 shred Fluffy_Pillow 44.3/100: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
1:58.822 shred Fluffy_Pillow 16.4/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
1:59.826 Waiting 1.000 sec 28.5/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
2:00.826 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
2:01.830 shred Fluffy_Pillow 51.3/100: 51% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages
2:02.834 healing_touch Fluffy_Pillow 62.0/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:03.752 Waiting 0.100 sec 72.1/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, blood_frenzy
2:03.852 savage_roar Fluffy_Pillow 73.3/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, blood_frenzy
2:04.857 rake Fluffy_Pillow 45.4/100: 45% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
2:05.862 lunar_inspiration Fluffy_Pillow 57.5/100: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
2:06.867 tigers_fury Fluffy_Pillow 39.6/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
2:06.867 shred Fluffy_Pillow 99.6/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, blood_frenzy
2:07.871 shred Fluffy_Pillow 86.7/100: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:08.874 healing_touch Fluffy_Pillow 73.8/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:09.709 Waiting 0.200 sec 83.8/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
2:09.909 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
2:10.913 shred Fluffy_Pillow 82.1/100: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:11.916 shred Fluffy_Pillow 54.2/100: 54% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:12.918 shred Fluffy_Pillow 66.2/100: 66% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:13.923 healing_touch Fluffy_Pillow 77.9/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
2:14.860 Waiting 0.200 sec 87.9/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:15.060 ferocious_bite Fluffy_Pillow 90.0/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:16.064 rake Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:17.070 Waiting 1.200 sec 26.6/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:18.270 lunar_inspiration Fluffy_Pillow 39.4/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:19.274 Waiting 1.689 sec 20.3/100: 20% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:20.963 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:21.968 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
2:22.803 savage_roar Fluffy_Pillow 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
2:24.063 rake Fluffy_Pillow 38.0/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:25.066 Waiting 2.126 sec 15.0/100: 15% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:27.192 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:28.195 Waiting 2.520 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:30.715 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:31.718 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:32.657 Waiting 0.805 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
2:33.462 rip Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
2:36.762 tigers_fury Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:36.867 rake Fluffy_Pillow 96.8/100: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
2:37.872 lunar_inspiration Fluffy_Pillow 87.5/100: 88% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
2:38.878 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
2:39.881 shred Fluffy_Pillow 86.4/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, blood_frenzy
2:40.886 shred Fluffy_Pillow 58.5/100: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, blood_frenzy
2:41.890 healing_touch Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:42.726 rip Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
2:43.731 rake Fluffy_Pillow 52.8/100: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:44.736 Waiting 0.900 sec 29.9/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:45.636 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:46.641 Waiting 1.512 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
2:48.153 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
2:49.159 Waiting 2.486 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
2:51.645 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:52.650 Waiting 1.330 sec 10.8/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:53.980 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
2:54.917 Waiting 0.500 sec 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), horrific_appendages
2:55.417 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), horrific_appendages
2:59.234 savage_roar Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons
3:00.240 ashamanes_frenzy Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:02.522 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:03.524 lunar_inspiration Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
3:04.529 healing_touch Fluffy_Pillow 22.9/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:05.466 rip Fluffy_Pillow 32.9/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:06.469 rake Fluffy_Pillow 13.6/100: 14% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
3:07.472 tigers_fury Fluffy_Pillow 24.4/100: 24% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:07.472 berserk Fluffy_Pillow 84.4/100: 84% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:07.472 shred Fluffy_Pillow 84.4/150: 56% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:08.476 shred Fluffy_Pillow 90.1/150: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:09.481 healing_touch Fluffy_Pillow 95.9/150: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:10.357 rip Fluffy_Pillow 105.9/150: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, blood_frenzy
3:11.362 shadowmeld Fluffy_Pillow 133.0/150: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:11.362 rake Fluffy_Pillow 133.0/150: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:11.362 auto_attack Fluffy_Pillow 115.5/150: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:12.365 shred Fluffy_Pillow 127.6/150: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:13.367 shred Fluffy_Pillow 119.6/150: 80% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:14.370 shred Fluffy_Pillow 111.7/150: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:15.375 healing_touch Fluffy_Pillow 103.8/150: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:16.207 savage_roar Fluffy_Pillow 113.8/150: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, blood_frenzy
3:17.212 lunar_inspiration Fluffy_Pillow 125.9/150: 84% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, blood_frenzy
3:18.217 shred Fluffy_Pillow 123.0/150: 82% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, blood_frenzy
3:19.223 shred Fluffy_Pillow 115.1/150: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy
3:20.229 shred Fluffy_Pillow 106.8/150: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:21.231 healing_touch Fluffy_Pillow 97.5/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:22.171 ferocious_bite Fluffy_Pillow 107.5/150: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:23.177 shred Fluffy_Pillow 93.3/100: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:24.183 shred Fluffy_Pillow 64.1/100: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:25.444 rake Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:26.449 healing_touch Fluffy_Pillow 14.9/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:27.285 Waiting 4.000 sec 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
3:31.285 rip Fluffy_Pillow 73.2/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
3:32.289 rake Fluffy_Pillow 55.3/100: 55% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
3:33.294 lunar_inspiration Fluffy_Pillow 32.4/100: 32% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:34.300 Waiting 2.274 sec 14.5/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:36.574 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:37.578 tigers_fury Fluffy_Pillow 10.8/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:37.578 healing_touch Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:38.515 Waiting 0.100 sec 80.8/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
3:38.615 rip Fluffy_Pillow 96.9/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
3:39.619 rake Fluffy_Pillow 92.6/100: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:40.626 shred Fluffy_Pillow 83.4/100: 83% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
3:41.630 shred Fluffy_Pillow 54.2/100: 54% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
3:42.634 Waiting 1.100 sec 24.9/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
3:43.734 lunar_inspiration Fluffy_Pillow 38.1/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:44.738 healing_touch Fluffy_Pillow 20.2/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:45.574 Waiting 1.700 sec 30.3/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
3:47.274 savage_roar Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), blood_frenzy
3:49.302 rake Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
3:50.307 Waiting 2.358 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
3:52.665 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:53.670 Waiting 2.771 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:56.441 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:57.445 Waiting 1.079 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:58.524 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:59.359 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar, blood_frenzy
4:00.364 Waiting 1.567 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, blood_frenzy
4:01.931 rip Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, blood_frenzy
4:02.936 Waiting 1.487 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:04.423 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:05.428 Waiting 1.987 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:07.415 tigers_fury Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:07.578 shred Fluffy_Pillow 98.6/100: 99% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:08.582 shred Fluffy_Pillow 84.4/100: 84% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:09.587 shred Fluffy_Pillow 71.5/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:10.593 healing_touch Fluffy_Pillow 98.6/100: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:11.427 savage_roar Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, blood_frenzy
4:12.433 rake Fluffy_Pillow 72.1/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:13.437 shred Fluffy_Pillow 49.2/100: 49% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:14.442 healing_touch Fluffy_Pillow 21.3/100: 21% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:15.276 ashamanes_frenzy Fluffy_Pillow 31.3/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
4:16.281 Waiting 1.800 sec 43.4/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, horrific_appendages, blood_frenzy
4:18.081 rip Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, horrific_appendages, blood_frenzy
4:19.086 lunar_inspiration Fluffy_Pillow 47.2/100: 47% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
4:20.091 shred Fluffy_Pillow 59.3/100: 59% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
4:21.095 Waiting 0.800 sec 31.4/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
4:21.895 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
4:22.902 healing_touch Fluffy_Pillow 13.2/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
4:23.736 Waiting 1.449 sec 23.2/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, blood_frenzy
4:25.185 savage_roar Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, blood_frenzy
4:28.230 rake Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
4:29.236 lunar_inspiration Fluffy_Pillow 14.4/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:30.241 Waiting 1.100 sec 26.5/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:31.341 rake Fluffy_Pillow 39.8/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:32.346 Waiting 1.675 sec 16.9/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:34.021 shred Fluffy_Pillow 37.0/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
4:35.026 shred Fluffy_Pillow 49.1/100: 49% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:36.030 healing_touch Fluffy_Pillow 21.2/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:36.864 rip Fluffy_Pillow 31.3/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
4:37.868 tigers_fury Fluffy_Pillow 13.3/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:37.868 rake Fluffy_Pillow 73.3/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:38.873 shred Fluffy_Pillow 65.4/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:39.877 shred Fluffy_Pillow 92.5/100: 93% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:40.880 shred Fluffy_Pillow 79.6/100: 80% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:41.884 healing_touch Fluffy_Pillow 51.7/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:42.720 Waiting 0.500 sec 61.8/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:43.220 rip Fluffy_Pillow 67.8/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:44.223 rake Fluffy_Pillow 79.9/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:45.227 lunar_inspiration Fluffy_Pillow 57.0/100: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:46.230 Waiting 0.100 sec 39.0/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy, jacins_ruse
4:46.330 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy, jacins_ruse
4:47.333 Waiting 2.354 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy, jacins_ruse
4:49.687 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy, jacins_ruse
4:50.693 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy, jacins_ruse
4:51.528 Waiting 4.283 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, blood_frenzy, jacins_ruse
4:55.811 savage_roar Fluffy_Pillow 74.4/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, blood_frenzy
4:56.815 rake Fluffy_Pillow 46.4/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages, blood_frenzy
4:57.819 Waiting 0.621 sec 23.5/100: 24% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:58.440 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:59.445 Waiting 1.180 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
5:01.648 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
5:02.654 shred Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:03.659 healing_touch Fluffy_Pillow 22.5/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:04.598 rip Fluffy_Pillow 32.5/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:05.603 Waiting 2.096 sec 13.3/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:07.699 tigers_fury Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:07.868 rake Fluffy_Pillow 97.5/100: 98% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:08.874 shred Fluffy_Pillow 88.3/100: 88% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:09.879 shred Fluffy_Pillow 74.0/100: 74% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:10.885 shred Fluffy_Pillow 59.8/100: 60% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:11.890 healing_touch Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:12.829 Waiting 4.100 sec 40.6/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:16.929 rip Fluffy_Pillow 88.7/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:17.934 rake Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:18.937 lunar_inspiration Fluffy_Pillow 47.8/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:19.942 Waiting 0.900 sec 29.9/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:20.842 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, blood_frenzy
5:21.847 healing_touch Fluffy_Pillow 12.9/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, blood_frenzy
5:22.936 savage_roar Fluffy_Pillow 26.0/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), horrific_appendages, blood_frenzy
5:23.941 Waiting 0.100 sec 37.9/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages
5:24.041 rake Fluffy_Pillow 39.0/100: 39% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages
5:25.046 Waiting 1.561 sec 14.7/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
5:26.607 shred Fluffy_Pillow 31.4/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
5:27.611 shred Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:28.617 Waiting 1.628 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:30.245 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:31.249 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages
5:32.186 Waiting 2.763 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
5:34.949 rip Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:35.954 ashamanes_frenzy Fluffy_Pillow 31.4/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:36.958 shred Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:37.962 tigers_fury Fluffy_Pillow 12.9/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:37.962 rake Fluffy_Pillow 72.9/100: 73% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:38.966 healing_touch Fluffy_Pillow 63.7/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:39.905 Waiting 0.100 sec 73.7/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:40.005 rip Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:41.008 shadowmeld Fluffy_Pillow 85.5/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:41.008 rake Fluffy_Pillow 85.5/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:41.008 auto_attack Fluffy_Pillow 50.5/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
5:42.012 shred Fluffy_Pillow 61.3/100: 61% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
5:43.017 lunar_inspiration Fluffy_Pillow 72.0/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
5:44.019 shred Fluffy_Pillow 52.7/100: 53% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:45.023 healing_touch Fluffy_Pillow 23.5/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
5:45.961 savage_roar Fluffy_Pillow 33.5/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
5:46.968 shred Fluffy_Pillow 44.3/100: 44% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:47.972 Waiting 0.931 sec 15.0/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:48.903 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:49.908 Waiting 0.400 sec 35.7/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:50.308 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:51.314 Waiting 2.827 sec 10.8/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:54.141 rake Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:55.145 healing_touch Fluffy_Pillow 53.2/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:55.979 Waiting 2.000 sec 63.3/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
5:57.979 ferocious_bite Fluffy_Pillow 87.3/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
5:58.983 rake Fluffy_Pillow 74.4/100: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:59.988 lunar_inspiration Fluffy_Pillow 51.5/100: 52% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:00.992 Waiting 0.600 sec 33.6/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:01.592 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:02.597 Waiting 2.302 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:04.899 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:05.903 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:06.737 Waiting 0.984 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
6:07.721 tigers_fury Fluffy_Pillow 34.6/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
6:07.962 berserk Fluffy_Pillow 97.5/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
6:07.962 potion Fluffy_Pillow 97.5/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, blood_frenzy
6:07.962 savage_roar Fluffy_Pillow 97.5/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:08.967 rake Fluffy_Pillow 104.6/150: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:09.971 shred Fluffy_Pillow 114.2/150: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:10.976 lunar_inspiration Fluffy_Pillow 121.3/150: 81% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:11.982 shred Fluffy_Pillow 118.4/150: 79% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:12.986 healing_touch Fluffy_Pillow 110.5/150: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:13.895 ferocious_bite Fluffy_Pillow 120.5/150: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:14.900 shred Fluffy_Pillow 106.3/150: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:15.905 shred Fluffy_Pillow 97.1/150: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:16.910 shred Fluffy_Pillow 87.8/150: 59% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:17.914 shred Fluffy_Pillow 78.6/150: 52% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:18.919 healing_touch Fluffy_Pillow 69.3/150: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:19.858 ferocious_bite Fluffy_Pillow 79.4/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:20.863 rake Fluffy_Pillow 77.6/150: 52% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:21.868 shred Fluffy_Pillow 70.9/150: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:22.871 shred Fluffy_Pillow 61.6/150: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:23.877 healing_touch Fluffy_Pillow 52.4/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:24.816 Waiting 2.600 sec 62.4/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:27.416 savage_roar Fluffy_Pillow 90.2/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:28.420 rake Fluffy_Pillow 61.0/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:29.427 lunar_inspiration Fluffy_Pillow 36.7/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:30.432 shred Fluffy_Pillow 17.5/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:31.434 Waiting 1.200 sec 28.2/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:32.634 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:33.639 Waiting 2.731 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:36.370 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:37.374 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:38.313 tigers_fury Fluffy_Pillow 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:38.313 ferocious_bite Fluffy_Pillow 81.8/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
6:39.319 rake Fluffy_Pillow 57.6/100: 58% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:40.324 lunar_inspiration Fluffy_Pillow 83.4/100: 83% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
6:41.328 shred Fluffy_Pillow 80.5/100: 81% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
6:42.332 healing_touch Fluffy_Pillow 52.6/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
6:43.167 Waiting 2.100 sec 62.7/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
6:45.267 ferocious_bite Fluffy_Pillow 88.0/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
6:46.272 rake Fluffy_Pillow 75.1/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:47.276 shred Fluffy_Pillow 52.2/100: 52% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:48.282 shred Fluffy_Pillow 24.3/100: 24% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
6:49.285 Waiting 0.400 sec 36.3/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:49.685 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:50.690 healing_touch Fluffy_Pillow 13.3/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:51.523 Waiting 3.742 sec 23.3/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
6:55.265 savage_roar Fluffy_Pillow 66.1/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
6:56.269 ashamanes_frenzy Fluffy_Pillow 76.8/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:57.272 rake Fluffy_Pillow 88.1/100: 88% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
6:58.277 lunar_inspiration Fluffy_Pillow 65.2/100: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:59.281 healing_touch Fluffy_Pillow 47.3/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:00.115 Waiting 2.600 sec 57.3/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
7:02.715 ferocious_bite Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
7:03.719 rake Fluffy_Pillow 75.7/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
7:04.724 shred Fluffy_Pillow 52.8/100: 53% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:05.729 Waiting 1.300 sec 24.9/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:07.029 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:08.033 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:08.972 tigers_fury Fluffy_Pillow 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:08.972 Waiting 0.800 sec 81.1/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
7:09.772 ferocious_bite Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
7:10.777 rake Fluffy_Pillow 90.5/100: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:11.782 lunar_inspiration Fluffy_Pillow 81.2/100: 81% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:12.786 shred Fluffy_Pillow 77.0/100: 77% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
7:13.791 healing_touch Fluffy_Pillow 47.7/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
7:14.729 Waiting 2.900 sec 57.7/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
7:17.629 savage_roar Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
7:18.634 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
7:19.639 shred Fluffy_Pillow 77.1/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
7:20.644 shred Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:21.648 shred Fluffy_Pillow 61.3/100: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:22.654 lunar_inspiration Fluffy_Pillow 33.4/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:23.658 healing_touch Fluffy_Pillow 15.5/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:24.493 Waiting 5.600 sec 25.5/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 23138 21431 11378 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 27766 25717 0
Crit 33.77% 33.77% 6220
Haste 7.01% 7.01% 2277
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 23138 21431 0
Mastery 57.32% 55.18% 6857
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 847.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Bloodthirsty Instinct
ilevel: 865, stats: { +1418 Agi }
Local Trinket2 Spontaneous Appendages
ilevel: 865, stats: { +986 Mastery }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="instinct_865 / appendages_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1805
trinket2=spontaneous_appendages,id=139325,bonus_id=1805
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=846.88
# gear_agility=11378
# gear_stamina=17628
# gear_crit_rating=6220
# gear_haste_rating=1518
# gear_mastery_rating=6857
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

instinct_865 / arcanocrystal_860 : 336363 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
336363.1 336363.1 415.0 / 0.123% 41523.2 / 12.3% 21988.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.3 15.3 Energy 29.98% 44.1 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
instinct_865 / arcanocrystal_860 336363
Ashamane's Frenzy 15926 4.7% 6.1 78.38sec 1171045 1165872 Direct 91.5 10687 21379 14550 36.1%  
Periodic 30.3 141403 282732 192751 36.3% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.12 91.52 121.79 30.27 1.0045 0.6474 7165446.48 7791467.50 8.03 84309.29 1165871.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.44 63.86% 10686.50 7946 12675 10688.23 9601 11713 624554 918154 31.98
crit 33.08 36.14% 21379.14 15892 25350 21380.24 19433 24536 707137 1039558 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.3 63.68% 141402.88 87610 174688 141420.38 125973 156449 2725835 2725835 0.00
crit 11.0 36.32% 282732.21 175220 349376 282763.55 242609 320453 3107920 3107920 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 40897 12.2% 19.0 22.28sec 969052 0 Periodic 151.3 89510 179047 121754 36.0% 43.4%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.01 0.00 151.31 151.31 0.0000 1.2901 18424012.54 18424012.54 0.00 94380.96 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.8 63.99% 89510.19 62 105815 89400.06 77679 96317 8666557 8666557 0.00
crit 54.5 36.01% 179047.20 124 211630 178871.98 150086 195442 9757455 9757455 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 31562 9.4% 535.0 0.84sec 26541 31696 Direct 535.0 19503 39001 26541 36.1%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 535.00 535.00 0.00 0.00 0.8374 0.0000 14199460.29 20874551.64 31.98 31696.21 31696.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 341.90 63.91% 19503.46 15173 21811 19503.19 19154 19836 6668239 9802943 31.98
crit 193.10 36.09% 39001.20 30346 43623 39001.04 38078 39769 7531221 11071609 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 7981 2.4% 11.5 40.53sec 311210 309819 Direct 11.5 215922 478628 311135 36.3%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.53 11.53 0.00 0.00 1.0045 0.0000 3589557.49 5276989.52 31.98 309818.53 309818.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.35 63.74% 215922.29 16561 273628 215438.86 81651 273628 1587534 2333826 31.98
crit 4.18 36.26% 478628.17 35092 604718 473307.69 0 604718 2002023 2943164 31.75
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 25650 7.6% 31.7 14.29sec 364238 362619 Direct 31.7 36040 72048 48986 36.0%  
Periodic 264.5 27752 55519 37766 36.1% 97.1%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.69 31.69 264.50 264.50 1.0045 1.6528 11541060.43 11541060.43 0.00 24608.12 362618.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.29 64.04% 36039.97 28021 40281 36037.20 33762 38029 731311 731311 0.00
crit 11.39 35.96% 72048.35 56043 80561 72024.10 63048 77559 820909 820909 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 169.1 63.94% 27751.53 69 31330 27751.36 26766 28402 4693146 4693146 0.00
crit 95.4 36.06% 55519.46 104 62660 55520.02 52805 57510 5295695 5295695 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2346 0.7% 25.4 17.53sec 41455 0 Periodic 75.1 14047 0 14047 0.0% 8.3%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.45 0.00 75.10 75.10 0.0000 0.4969 1055007.91 1550961.56 31.98 28273.78 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.1 100.00% 14047.49 27 15789 14050.11 13261 14834 1055008 1550962 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 12211 3.6% 24.9 16.21sec 217759 0 Direct 24.9 159689 319493 217757 36.3%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.92 24.92 0.00 0.00 0.0000 0.0000 5426992.06 7978192.39 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.87 63.66% 159688.72 124406 178834 159670.32 145733 171058 2533452 3724415 31.98
crit 9.06 36.34% 319493.00 248812 357668 319462.70 269547 357668 2893540 4253778 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 75944 22.6% 47.6 9.48sec 717909 714694 Direct 47.6 91879 183313 124731 35.9%  
Periodic 223.7 92732 185337 126207 36.1% 95.2%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.60 47.60 223.70 223.70 1.0045 1.9156 34169501.34 34169501.34 0.00 71735.54 714693.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.49 64.07% 91879.38 42962 205589 91892.21 78304 104108 2801650 2801650 0.00
crit 17.10 35.93% 183313.22 85923 411177 183404.04 142105 233750 3135251 3135251 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 142.8 63.85% 92732.00 40 205589 92745.47 81587 101985 13245611 13245611 0.00
crit 80.9 36.15% 185336.90 171 411177 185443.53 159322 219604 14986989 14986989 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 91258 27.2% 23.2 15.22sec 1774469 1766554 Periodic 327.8 92103 184186 125333 36.1% 96.6%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.15 0.00 327.80 327.80 1.0045 1.3265 41084735.65 41084735.65 0.00 89687.63 1766553.54
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 209.5 63.91% 92102.63 71 105815 92096.08 86597 96065 19296970 19296970 0.00
crit 118.3 36.09% 184185.85 142 211630 184172.80 170461 193429 21787766 21787766 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 32587 9.7% 113.6 3.95sec 128960 128383 Direct 113.6 94729 189512 128960 36.1%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.61 113.61 0.00 0.00 1.0045 0.0000 14650640.49 21537829.27 31.98 128382.63 128382.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.58 63.89% 94729.26 66148 142632 94750.95 88919 100202 6875365 10107438 31.98
crit 41.03 36.11% 189511.79 132296 285264 189473.37 170459 207078 7775275 11430391 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
instinct_865 / arcanocrystal_860
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_865 / arcanocrystal_860
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.07sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_865 / arcanocrystal_860
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_865 / arcanocrystal_860
  • harmful:false
  • if_expr:
 
Healing Touch 52.1 8.74sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 52.09 0.00 0.00 0.00 0.8375 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.8 24.40sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.82 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.33sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.35sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.10% 10.17% 45.4(45.4) 15.1

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 14.53% 0.0(0.0) 2.9

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Blood Frenzy 14.6 7.7 30.6sec 19.6sec 40.25% 40.31% 7.7(7.7) 14.2

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2902.15

Stack Uptimes

  • blood_frenzy_1:40.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 7.42% 0.0(0.0) 1.0

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 52.0 0.0 8.7sec 8.7sec 46.23% 46.27% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.54%
  • bloodtalons_2:27.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 45.2 1.6 9.8sec 9.5sec 6.76% 15.37% 1.6(1.6) 0.0

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.76%

Trigger Attempt Success

  • trigger_pct:8.73%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.7 1.9 63.2sec 47.9sec 24.92% 25.00% 1.9(1.9) 6.4

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.5sec 0.0sec 10.81% 10.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 51.8 1.1 8.7sec 8.5sec 74.37% 74.39% 1.1(1.1) 0.0

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.37%

Trigger Attempt Success

  • trigger_pct:98.81%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 7.5 11.3 51.9sec 24.4sec 94.33% 94.09% 202.8(202.8) 6.5

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:94.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.0sec 133.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.78% 28.98% 0.0(0.0) 14.9

Buff details

  • buff initial source:instinct_865 / arcanocrystal_860
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
instinct_865 / arcanocrystal_860
ferocious_bite Energy 23.1 398.0 17.3 34.5 9018.2
ferocious_bite Combo Points 11.5 54.5 4.7 4.7 65889.0
lunar_inspiration Energy 31.7 786.7 24.8 24.8 14670.7
rake Energy 47.6 1354.7 28.5 28.5 25223.5
rip Energy 23.2 465.7 20.1 20.1 88220.1
rip Combo Points 23.2 115.8 5.0 5.0 354902.7
savage_roar Energy 18.8 483.5 25.7 25.7 0.0
savage_roar Combo Points 18.8 94.1 5.0 5.0 0.0
shred Energy 113.6 3392.6 29.9 29.9 4318.4
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.60 47.60 (17.79%) 1.00 0.00 0.00%
tigers_fury Energy 15.20 911.19 (10.87%) 59.96 0.58 0.06%
ashamanes_frenzy Combo Points 6.12 18.36 (6.86%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.69 31.69 (11.84%) 1.00 0.00 0.00%
shred Combo Points 113.60 113.60 (42.46%) 1.00 0.00 0.00%
energy_regen Energy 2042.98 5278.10 (62.94%) 2.58 84.92 1.58%
clearcasting Energy 45.06 1537.17 (18.33%) 34.11 0.00 0.00%
ashamanes_energy Energy 45.39 659.14 (7.86%) 14.52 21.76 3.20%
primal_fury Combo Points 69.52 56.30 (21.04%) 0.81 13.22 19.01%
Resource RPS-Gain RPS-Loss
Energy 15.22 15.29
Combo Points 0.59 0.59
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 39.19 0.17 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.15 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.9%

Procs

Count Interval
clearcasting 46.7 9.5sec
clearcasting_wasted 1.6 117.2sec
primal_fury 69.5 6.5sec

Statistics & Data Analysis

Fight Length
Sample Data instinct_865 / arcanocrystal_860 Fight Length
Count 2499
Mean 450.05
Minimum 360.07
Maximum 539.96
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data instinct_865 / arcanocrystal_860 Damage Per Second
Count 2499
Mean 336363.12
Minimum 298464.24
Maximum 377887.61
Spread ( max - min ) 79423.37
Range [ ( max - min ) / 2 * 100% ] 11.81%
Standard Deviation 10585.9500
5th Percentile 318739.93
95th Percentile 354108.41
( 95th Percentile - 5th Percentile ) 35368.48
Mean Distribution
Standard Deviation 211.7614
95.00% Confidence Intervall ( 335948.08 - 336778.17 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3804
0.1 Scale Factor Error with Delta=300 956628
0.05 Scale Factor Error with Delta=300 3826514
0.01 Scale Factor Error with Delta=300 95662855
Priority Target DPS
Sample Data instinct_865 / arcanocrystal_860 Priority Target Damage Per Second
Count 2499
Mean 336363.12
Minimum 298464.24
Maximum 377887.61
Spread ( max - min ) 79423.37
Range [ ( max - min ) / 2 * 100% ] 11.81%
Standard Deviation 10585.9500
5th Percentile 318739.93
95th Percentile 354108.41
( 95th Percentile - 5th Percentile ) 35368.48
Mean Distribution
Standard Deviation 211.7614
95.00% Confidence Intervall ( 335948.08 - 336778.17 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3804
0.1 Scale Factor Error with Delta=300 956628
0.05 Scale Factor Error with Delta=300 3826514
0.01 Scale Factor Error with Delta=300 95662855
DPS(e)
Sample Data instinct_865 / arcanocrystal_860 Damage Per Second (Effective)
Count 2499
Mean 336363.12
Minimum 298464.24
Maximum 377887.61
Spread ( max - min ) 79423.37
Range [ ( max - min ) / 2 * 100% ] 11.81%
Damage
Sample Data instinct_865 / arcanocrystal_860 Damage
Count 2499
Mean 151306414.68
Minimum 111068261.10
Maximum 194212492.82
Spread ( max - min ) 83144231.72
Range [ ( max - min ) / 2 * 100% ] 27.48%
DTPS
Sample Data instinct_865 / arcanocrystal_860 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data instinct_865 / arcanocrystal_860 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data instinct_865 / arcanocrystal_860 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data instinct_865 / arcanocrystal_860 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data instinct_865 / arcanocrystal_860 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data instinct_865 / arcanocrystal_860 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data instinct_865 / arcanocrystal_860Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data instinct_865 / arcanocrystal_860 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.57 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.57 auto_attack
0.00 skull_bash
A 2.95 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.20 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 3.61 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 51.09 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 7.47 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 23.15 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 11.35 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 7.92 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.12 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.57 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 43.02 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.69 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 113.60 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQQCAIQEMJQQOPELOQQQEJQQQEKOPQEJCN89QQQQEKPQOQEJOPQQECJOQQEKOPQEJOQPEKMOEJQQCQQPEJOQQQEKOPQQQEJOCPQQEJOQQEKQOQPQEJOQQPECJN89QQQEKMPEJOQQELOQPQEJCAOQQEIQQQQELOPQQQEJOQQEKOCPQQEJOQQPEKOQQEOPJCQQEMJQQQOPEKOQQQEJOPCQEJN89QQQEIPOQQQEJOPQCQEJOQQEIOPQQEJMOPEKCOQQQEDOPQQEODPQQCABEIOQQPEJOQQQELQQQQEKOPOELCOQQPQEKMOQEDOPQELOQQCPEKN89QQELQPOE

Sample Sequence Table

time name target resources buffs
Pre flask instinct_865 / arcanocrystal_860 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food instinct_865 / arcanocrystal_860 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation instinct_865 / arcanocrystal_860 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, blood_frenzy, potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 78.2/100: 78% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, blood_frenzy, potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 64.4/100: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, blood_frenzy, potion_of_the_old_war
0:03.014 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, blood_frenzy, potion_of_the_old_war
0:04.019 tigers_fury Fluffy_Pillow 16.9/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, blood_frenzy, potion_of_the_old_war
0:04.019 berserk Fluffy_Pillow 76.9/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, tigers_fury, blood_frenzy, potion_of_the_old_war
0:04.019 savage_roar Fluffy_Pillow 76.9/150: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, blood_frenzy, potion_of_the_old_war
0:05.023 shred Fluffy_Pillow 88.1/150: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:06.028 healing_touch Fluffy_Pillow 99.3/150: 66% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:06.782 ashamanes_frenzy Fluffy_Pillow 111.4/150: 74% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:07.786 rip Fluffy_Pillow 142.6/150: 95% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:08.789 shred Fluffy_Pillow 143.8/150: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:09.791 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:10.796 rake Fluffy_Pillow 144.8/150: 97% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:11.799 lunar_inspiration Fluffy_Pillow 141.8/150: 95% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:12.801 healing_touch Fluffy_Pillow 141.2/150: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:13.556 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
0:14.562 rake Fluffy_Pillow 141.2/150: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:15.565 shred Fluffy_Pillow 139.9/150: 93% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:16.569 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:17.575 shred Fluffy_Pillow 146.2/150: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:18.578 healing_touch Fluffy_Pillow 142.4/150: 95% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:19.333 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse, potion_of_the_old_war
0:20.337 shred Fluffy_Pillow 86.2/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:21.341 shred Fluffy_Pillow 62.4/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:22.345 Waiting 0.100 sec 38.6/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:22.445 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:23.449 healing_touch Fluffy_Pillow 16.4/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy
0:24.281 Waiting 0.700 sec 28.6/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar
0:24.981 savage_roar Fluffy_Pillow 38.7/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar
0:25.984 rake Fluffy_Pillow 53.1/100: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:26.991 lunar_inspiration Fluffy_Pillow 32.6/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:27.995 Waiting 1.652 sec 17.0/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:29.647 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:30.653 healing_touch Fluffy_Pillow 15.3/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:31.408 Waiting 0.600 sec 26.2/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:32.008 rip Fluffy_Pillow 34.8/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:33.778 tigers_fury Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:34.019 shadowmeld Fluffy_Pillow 93.8/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.019 rake Fluffy_Pillow 93.8/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.019 auto_attack Fluffy_Pillow 58.8/100: 59% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.022 shred Fluffy_Pillow 88.2/100: 88% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.027 shred Fluffy_Pillow 77.7/100: 78% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:37.031 shred Fluffy_Pillow 67.1/100: 67% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:38.035 shred Fluffy_Pillow 41.6/100: 42% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.041 healing_touch Fluffy_Pillow 16.1/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.794 Waiting 4.400 sec 26.9/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:44.194 savage_roar Fluffy_Pillow 79.6/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:45.199 lunar_inspiration Fluffy_Pillow 91.6/100: 92% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
0:46.203 shred Fluffy_Pillow 74.1/100: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
0:47.207 rake Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:48.212 Waiting 1.300 sec 24.0/100: 24% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:49.512 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:50.516 healing_touch Fluffy_Pillow 12.6/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
0:51.325 Waiting 1.590 sec 22.6/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
0:52.915 rip Fluffy_Pillow 42.4/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
0:54.936 rake Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
0:55.941 Waiting 1.577 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
0:57.518 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
0:58.521 Waiting 2.006 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:00.527 shred Fluffy_Pillow 33.9/100: 34% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
1:01.531 shred Fluffy_Pillow 45.0/100: 45% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:02.536 healing_touch Fluffy_Pillow 16.1/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:03.443 Waiting 0.400 sec 26.1/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:03.843 tigers_fury Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:04.019 rip Fluffy_Pillow 92.5/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:05.022 rake Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:06.028 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:07.035 shred Fluffy_Pillow 86.2/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:08.039 healing_touch Fluffy_Pillow 57.3/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:08.947 Waiting 2.000 sec 67.3/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:10.947 savage_roar Fluffy_Pillow 89.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:11.952 rake Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
1:12.957 lunar_inspiration Fluffy_Pillow 36.7/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:13.962 Waiting 2.045 sec 17.9/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
1:16.007 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
1:17.013 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
1:17.919 Waiting 0.300 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:18.219 rip Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:19.223 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
1:20.229 shred Fluffy_Pillow 47.3/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:21.233 Waiting 1.798 sec 18.4/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:23.031 lunar_inspiration Fluffy_Pillow 38.3/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:24.036 healing_touch Fluffy_Pillow 19.4/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:24.943 Waiting 4.000 sec 29.5/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:28.943 savage_roar Fluffy_Pillow 76.8/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
1:29.949 ashamanes_frenzy Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
1:30.953 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
1:31.957 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:32.767 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:33.772 shred Fluffy_Pillow 82.5/100: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
1:34.776 shred Fluffy_Pillow 54.9/100: 55% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:35.783 tigers_fury Fluffy_Pillow 27.4/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:35.783 shred Fluffy_Pillow 87.4/100: 87% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:36.790 shred Fluffy_Pillow 74.8/100: 75% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:37.795 lunar_inspiration Fluffy_Pillow 60.9/100: 61% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:38.800 healing_touch Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:39.609 rip Fluffy_Pillow 68.0/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
1:40.612 rake Fluffy_Pillow 80.5/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:41.616 shred Fluffy_Pillow 57.9/100: 58% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:42.620 Waiting 0.800 sec 30.4/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:43.420 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:44.424 shred Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
1:45.429 healing_touch Fluffy_Pillow 25.3/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:46.239 Waiting 4.300 sec 35.3/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:50.539 savage_roar Fluffy_Pillow 88.7/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:51.545 rake Fluffy_Pillow 61.2/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
1:52.547 lunar_inspiration Fluffy_Pillow 38.6/100: 39% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
1:53.551 Waiting 1.828 sec 20.3/100: 20% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:55.379 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:56.385 Waiting 1.607 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:57.992 shred Fluffy_Pillow 29.4/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
1:58.996 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:00.001 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:00.908 Waiting 0.796 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:01.704 rip Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:05.008 rake Fluffy_Pillow 38.1/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:06.014 tigers_fury Fluffy_Pillow 15.6/100: 16% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:06.014 lunar_inspiration Fluffy_Pillow 75.6/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
2:07.019 shred Fluffy_Pillow 73.0/100: 73% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
2:08.024 shred Fluffy_Pillow 60.5/100: 61% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
2:09.029 healing_touch Fluffy_Pillow 48.0/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
2:09.839 rip Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, blood_frenzy, jacins_ruse
2:10.843 rake Fluffy_Pillow 70.5/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
2:11.846 shred Fluffy_Pillow 83.0/100: 83% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
2:12.851 shred Fluffy_Pillow 55.4/100: 55% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
2:13.855 healing_touch Fluffy_Pillow 27.9/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:14.664 Waiting 0.800 sec 37.9/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
2:15.464 savage_roar Fluffy_Pillow 47.9/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
2:16.469 shred Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
2:17.473 rake Fluffy_Pillow 72.8/100: 73% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:18.476 shred Fluffy_Pillow 50.3/100: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:19.480 Waiting 0.684 sec 22.7/100: 23% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:20.164 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:21.169 Waiting 2.212 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:23.381 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:24.387 healing_touch Fluffy_Pillow 13.6/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:25.197 rip Fluffy_Pillow 23.7/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
2:26.200 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:27.205 Waiting 2.218 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:29.423 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:30.428 Waiting 2.460 sec 13.3/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:32.888 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:33.892 lunar_inspiration Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
2:34.896 healing_touch Fluffy_Pillow 22.7/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:35.804 tigers_fury Fluffy_Pillow 32.8/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:36.014 rip Fluffy_Pillow 95.1/100: 95% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:37.020 shadowmeld Fluffy_Pillow 91.2/100: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:37.020 rake Fluffy_Pillow 91.2/100: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:37.020 auto_attack Fluffy_Pillow 56.2/100: 56% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:38.024 shred Fluffy_Pillow 82.4/100: 82% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:39.030 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:40.035 shred Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
2:41.040 healing_touch Fluffy_Pillow 42.3/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
2:41.947 Waiting 3.400 sec 52.3/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:45.347 savage_roar Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:46.351 ashamanes_frenzy Fluffy_Pillow 61.1/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:47.357 lunar_inspiration Fluffy_Pillow 72.2/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:48.360 healing_touch Fluffy_Pillow 53.3/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, predatory_swiftness, savage_roar
2:49.267 rip Fluffy_Pillow 63.4/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:50.273 rake Fluffy_Pillow 74.5/100: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:51.277 shred Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
2:52.281 shred Fluffy_Pillow 61.7/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:53.284 healing_touch Fluffy_Pillow 32.8/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
2:54.191 Waiting 4.200 sec 42.9/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
2:58.391 ferocious_bite Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
2:59.395 rake Fluffy_Pillow 75.5/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:00.401 shred Fluffy_Pillow 86.6/100: 87% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:01.406 lunar_inspiration Fluffy_Pillow 57.8/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:02.412 Waiting 0.100 sec 38.9/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:02.512 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:03.517 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
3:04.326 Waiting 0.773 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
3:05.099 rip Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
3:06.103 tigers_fury Fluffy_Pillow 13.7/100: 14% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
3:06.103 berserk Fluffy_Pillow 73.7/100: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
3:06.103 rake Fluffy_Pillow 73.7/150: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
3:07.107 shred Fluffy_Pillow 83.6/150: 56% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
3:08.112 shred Fluffy_Pillow 91.1/150: 61% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
3:09.117 healing_touch Fluffy_Pillow 98.6/150: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:09.926 savage_roar Fluffy_Pillow 108.6/150: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, tigers_fury, blood_frenzy
3:10.930 shred Fluffy_Pillow 121.1/150: 81% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:11.935 shred Fluffy_Pillow 113.6/150: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:12.940 shred Fluffy_Pillow 106.0/150: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:13.946 shred Fluffy_Pillow 97.5/150: 65% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:14.951 healing_touch Fluffy_Pillow 88.7/150: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:15.859 ferocious_bite Fluffy_Pillow 98.7/150: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:16.865 rake Fluffy_Pillow 84.8/150: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:17.870 lunar_inspiration Fluffy_Pillow 78.5/150: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar
3:18.874 shred Fluffy_Pillow 74.6/150: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar
3:19.880 shred Fluffy_Pillow 65.7/150: 44% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:20.884 shred Fluffy_Pillow 56.9/150: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar
3:21.889 healing_touch Fluffy_Pillow 48.0/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:22.795 Waiting 2.800 sec 58.0/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:25.595 rip Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:26.602 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:27.606 shred Fluffy_Pillow 76.1/100: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:28.611 shred Fluffy_Pillow 47.2/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:29.616 healing_touch Fluffy_Pillow 18.4/100: 18% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:30.523 Waiting 2.600 sec 28.4/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:33.123 savage_roar Fluffy_Pillow 57.2/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:34.897 rake Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:35.904 tigers_fury Fluffy_Pillow 13.0/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:36.103 lunar_inspiration Fluffy_Pillow 75.2/100: 75% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:37.108 shred Fluffy_Pillow 71.3/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:38.113 shred Fluffy_Pillow 57.5/100: 57% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:39.117 healing_touch Fluffy_Pillow 43.6/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
3:40.013 Waiting 2.100 sec 53.6/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
3:42.113 rip Fluffy_Pillow 79.7/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
3:43.119 rake Fluffy_Pillow 92.2/100: 92% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:44.124 shred Fluffy_Pillow 69.7/100: 70% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:45.128 shred Fluffy_Pillow 42.1/100: 42% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:46.133 Waiting 1.337 sec 14.6/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:47.470 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:48.475 healing_touch Fluffy_Pillow 13.7/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:49.284 savage_roar Fluffy_Pillow 23.7/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
3:50.287 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
3:51.292 Waiting 2.315 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
3:53.607 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:54.610 Waiting 2.621 sec 11.5/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:57.231 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:58.233 Waiting 1.610 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:59.843 healing_touch Fluffy_Pillow 29.4/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:00.750 rake Fluffy_Pillow 39.5/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar
4:01.754 Waiting 1.350 sec 15.6/100: 16% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar
4:03.104 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar
4:04.109 Waiting 1.204 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
4:05.313 rip Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar
4:06.318 tigers_fury Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:06.318 shred Fluffy_Pillow 97.5/100: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:07.321 shred Fluffy_Pillow 84.9/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:08.326 healing_touch Fluffy_Pillow 72.4/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:09.134 ashamanes_frenzy Fluffy_Pillow 82.4/100: 82% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
4:10.139 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar, tigers_fury, blood_frenzy
4:11.143 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:12.149 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:13.153 shred Fluffy_Pillow 72.5/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:14.158 rake Fluffy_Pillow 44.9/100: 45% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:15.162 Waiting 0.709 sec 22.4/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:15.871 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:16.875 healing_touch Fluffy_Pillow 13.7/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
4:17.684 savage_roar Fluffy_Pillow 23.7/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
4:18.689 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
4:19.694 shred Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:20.697 Waiting 1.540 sec 23.4/100: 23% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:22.237 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:23.243 Waiting 2.606 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:25.849 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:26.854 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:27.760 Waiting 2.501 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:30.261 rip Fluffy_Pillow 49.4/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:31.774 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:32.779 Waiting 1.652 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:34.431 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:35.437 Waiting 1.204 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:36.641 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:36.641 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:37.645 healing_touch Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:38.552 rip Fluffy_Pillow 81.2/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
4:39.555 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:39.555 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:39.555 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:40.560 shred Fluffy_Pillow 91.1/100: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:41.566 shred Fluffy_Pillow 62.3/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:42.572 Waiting 0.600 sec 33.4/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:43.172 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:44.177 healing_touch Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:46.871 savage_roar Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), blood_frenzy, jacins_ruse
4:47.876 Waiting 1.417 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:49.293 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:50.297 Waiting 1.613 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:52.163 rake Fluffy_Pillow 36.8/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
4:53.168 Waiting 0.862 sec 14.3/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:54.030 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:55.036 Waiting 0.300 sec 37.5/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:55.336 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:56.340 Waiting 0.912 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:57.252 shred Fluffy_Pillow 24.4/100: 24% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
4:58.255 healing_touch Fluffy_Pillow 35.5/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:59.163 Waiting 0.300 sec 45.5/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:59.463 rip Fluffy_Pillow 48.8/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:00.975 rake Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:01.980 Waiting 1.200 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:03.180 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
5:04.185 Waiting 0.400 sec 36.1/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:04.585 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:05.588 Waiting 1.204 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:06.792 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:06.792 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:07.796 healing_touch Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:08.703 Waiting 0.100 sec 81.2/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:08.803 rip Fluffy_Pillow 97.3/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:09.807 rake Fluffy_Pillow 93.4/100: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:10.812 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
5:11.816 shred Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
5:12.820 healing_touch Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
5:13.726 savage_roar Fluffy_Pillow 52.3/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
5:14.731 Waiting 0.644 sec 23.4/100: 23% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
5:15.886 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:16.891 lunar_inspiration Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:17.894 Waiting 1.542 sec 23.4/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:19.436 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
5:20.442 Waiting 2.606 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:23.048 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:24.054 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:24.962 Waiting 2.499 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:27.461 rip Fluffy_Pillow 49.4/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:28.466 ashamanes_frenzy Fluffy_Pillow 30.5/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:29.472 rake Fluffy_Pillow 41.6/100: 42% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:30.477 Waiting 1.154 sec 17.8/100: 18% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:31.631 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:32.637 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:33.545 Waiting 1.695 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:35.240 savage_roar Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:36.755 tigers_fury Fluffy_Pillow 17.3/100: 17% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:36.792 rake Fluffy_Pillow 77.7/100: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:37.797 shred Fluffy_Pillow 68.8/100: 69% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:38.799 shred Fluffy_Pillow 56.2/100: 56% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:39.803 shred Fluffy_Pillow 43.7/100: 44% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:40.809 healing_touch Fluffy_Pillow 56.2/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:41.617 Waiting 1.200 sec 66.2/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:42.817 ferocious_bite Fluffy_Pillow 81.1/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
5:43.822 rake Fluffy_Pillow 43.6/100: 44% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:44.825 Waiting 0.818 sec 21.0/100: 21% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:45.643 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:46.649 Waiting 2.311 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:48.960 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:49.965 Waiting 2.579 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:52.544 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:53.548 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:55.736 rake Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
5:56.741 Waiting 2.176 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:58.917 ferocious_bite Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:59.921 Waiting 1.753 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
6:01.674 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:02.679 Waiting 2.604 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, jacins_ruse
6:05.283 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, jacins_ruse
6:06.287 shred Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, jacins_ruse
6:07.290 tigers_fury Fluffy_Pillow 22.7/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, jacins_ruse
6:07.290 berserk Fluffy_Pillow 82.7/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, jacins_ruse
6:07.290 potion Fluffy_Pillow 82.7/150: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, tigers_fury, jacins_ruse
6:07.290 healing_touch Fluffy_Pillow 82.7/150: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, tigers_fury, jacins_ruse, potion_of_the_old_war
6:08.199 savage_roar Fluffy_Pillow 92.8/150: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, tigers_fury, jacins_ruse, potion_of_the_old_war
6:09.204 rake Fluffy_Pillow 98.9/150: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:10.210 shred Fluffy_Pillow 107.5/150: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:11.214 shred Fluffy_Pillow 113.7/150: 76% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:12.217 lunar_inspiration Fluffy_Pillow 104.8/150: 70% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:13.222 healing_touch Fluffy_Pillow 100.9/150: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:14.088 rip Fluffy_Pillow 111.0/150: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:15.092 rake Fluffy_Pillow 108.4/150: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse, potion_of_the_old_war
6:16.095 shred Fluffy_Pillow 103.4/150: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:17.100 shred Fluffy_Pillow 95.8/150: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:18.104 shred Fluffy_Pillow 88.3/150: 59% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:19.109 healing_touch Fluffy_Pillow 80.8/150: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:19.920 ferocious_bite Fluffy_Pillow 90.9/150: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, blood_frenzy, potion_of_the_old_war
6:20.925 shred Fluffy_Pillow 78.3/150: 52% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:21.931 shred Fluffy_Pillow 70.8/150: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:22.935 shred Fluffy_Pillow 63.3/100: 63% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:23.940 Waiting 0.500 sec 35.5/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:24.440 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:25.445 healing_touch Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:26.351 Waiting 0.654 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:27.005 savage_roar Fluffy_Pillow 29.4/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, potion_of_the_old_war
6:28.010 rake Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, potion_of_the_old_war
6:29.015 lunar_inspiration Fluffy_Pillow 16.7/100: 17% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:30.018 Waiting 1.200 sec 27.8/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:31.218 rake Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:32.222 healing_touch Fluffy_Pillow 17.2/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:33.130 Waiting 2.100 sec 27.2/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:35.230 ferocious_bite Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
6:36.234 Waiting 0.955 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
6:37.189 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
6:37.290 rake Fluffy_Pillow 86.2/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:38.295 shred Fluffy_Pillow 78.7/100: 79% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:39.300 shred Fluffy_Pillow 66.2/100: 66% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:40.305 lunar_inspiration Fluffy_Pillow 53.7/100: 54% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:41.311 Waiting 0.400 sec 36.2/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:41.711 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:42.718 healing_touch Fluffy_Pillow 13.6/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:43.528 Waiting 2.906 sec 23.7/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
6:46.434 savage_roar Fluffy_Pillow 59.8/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
6:47.438 ashamanes_frenzy Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:48.442 rake Fluffy_Pillow 82.3/100: 82% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
6:49.449 shred Fluffy_Pillow 58.5/100: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:50.453 healing_touch Fluffy_Pillow 29.6/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
6:51.359 Waiting 1.800 sec 39.6/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
6:53.159 ferocious_bite Fluffy_Pillow 59.6/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
6:54.164 rake Fluffy_Pillow 45.7/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:55.167 Waiting 0.787 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:55.954 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:56.958 Waiting 2.606 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:59.564 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:00.568 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:01.475 Waiting 2.901 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:04.376 ferocious_bite Fluffy_Pillow 53.8/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
7:05.381 rake Fluffy_Pillow 39.9/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
7:06.387 shred Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
7:07.390 shred Fluffy_Pillow 62.2/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:08.394 tigers_fury Fluffy_Pillow 33.3/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:08.394 lunar_inspiration Fluffy_Pillow 93.3/100: 93% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
7:09.399 healing_touch Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
7:10.307 savage_roar Fluffy_Pillow 99.5/100: 99% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
7:11.311 shadowmeld Fluffy_Pillow 85.6/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:11.311 rake Fluffy_Pillow 85.6/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:11.311 auto_attack Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:12.315 shred Fluffy_Pillow 76.7/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
7:13.319 shred Fluffy_Pillow 47.8/100: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
7:14.324 healing_touch Fluffy_Pillow 19.4/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:15.132 Waiting 4.700 sec 29.4/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
7:19.832 ferocious_bite Fluffy_Pillow 87.7/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
7:20.835 shred Fluffy_Pillow 50.2/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
7:21.839 Waiting 0.690 sec 22.6/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:22.529 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:23.532 Waiting 0.914 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:25.470 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:26.474 healing_touch Fluffy_Pillow 15.2/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:27.284 Waiting 2.800 sec 25.2/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 23138 21431 11378 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 27766 25717 0
Crit 36.08% 36.08% 7027
Haste 10.73% 10.73% 3488
Damage / Heal Versatility 7.65% 7.65% 3058
Attack Power 23138 21431 0
Mastery 56.30% 54.16% 6678
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 847.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Bloodthirsty Instinct
ilevel: 865, stats: { +1418 Agi }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="instinct_865 / arcanocrystal_860"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1805
trinket2=unstable_arcanocrystal,id=141482
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=846.56
# gear_agility=11378
# gear_stamina=17628
# gear_crit_rating=7027
# gear_haste_rating=2325
# gear_mastery_rating=6678
# gear_versatility_rating=3058
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

instinct_865 / call_865 : 324617 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
324617.3 324617.3 411.6 / 0.127% 41142.4 / 12.7% 21353.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.2 15.2 Energy 30.09% 43.9 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
instinct_865 / call_865 324617
Ashamane's Frenzy 15382 4.7% 6.1 78.34sec 1130216 1125226 Direct 91.6 10391 20787 14067 35.4%  
Periodic 30.3 137424 275121 186084 35.3% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.12 91.60 121.86 30.26 1.0045 0.6470 6920142.76 7525866.94 8.05 81414.40 1125226.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.21 64.64% 10391.19 7661 13357 10391.71 9319 11491 615199 904401 31.98
crit 32.39 35.36% 20786.79 15323 26713 20791.95 18522 23297 673316 989839 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.6 64.66% 137424.40 84472 184084 137418.50 121713 153004 2689439 2689439 0.00
crit 10.7 35.34% 275120.54 168944 368168 275224.66 230639 317883 2942188 2942188 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 39207 12.1% 19.0 22.07sec 927180 0 Periodic 149.6 87068 174109 117895 35.4% 42.9%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.03 0.00 149.63 149.63 0.0000 1.2903 17640528.48 17640528.48 0.00 91369.04 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.6 64.58% 87067.91 60 111506 86970.67 77689 94429 8413573 8413573 0.00
crit 53.0 35.42% 174108.95 119 223013 173998.50 152776 192756 9226955 9226955 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 30525 9.4% 530.3 0.85sec 25900 30661 Direct 530.3 19130 38258 25900 35.4%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 530.27 530.27 0.00 0.00 0.8447 0.0000 13734142.99 20190491.12 31.98 30660.81 30660.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 342.58 64.60% 19130.25 14889 21403 19129.70 18713 19436 6553579 9634382 31.98
crit 187.69 35.40% 38257.65 29778 42805 38256.97 37231 38960 7180564 10556109 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 7502 2.3% 11.3 41.44sec 299458 298132 Direct 11.3 209321 463312 299438 35.5%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.26 11.26 0.00 0.00 1.0045 0.0000 3372768.39 4958289.00 31.98 298132.09 298132.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.27 64.52% 209320.81 16235 268499 209156.41 65543 259744 1521029 2236057 31.98
crit 4.00 35.48% 463312.34 35750 593384 457825.41 0 593384 1851739 2722232 31.70
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 24827 7.7% 31.7 14.32sec 352858 351288 Direct 31.7 35330 70587 47723 35.2%  
Periodic 262.1 27219 54438 36858 35.4% 97.1%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.66 31.66 262.11 262.11 1.0045 1.6666 11172011.83 11172011.83 0.00 23839.47 351287.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.53 64.84% 35329.92 27496 39526 35328.20 33194 37206 725314 725314 0.00
crit 11.13 35.16% 70587.22 54992 79051 70566.70 61866 79051 785744 785744 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 169.3 64.59% 27218.86 15 30743 27217.93 26465 27876 4607867 4607867 0.00
crit 92.8 35.41% 54438.15 29 61485 54436.14 51685 56166 5053087 5053087 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2293 0.7% 25.3 17.68sec 40737 0 Periodic 74.8 13792 0 13792 0.0% 8.3%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.32 0.00 74.78 74.78 0.0000 0.4969 1031356.20 1516191.31 31.98 27757.46 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.8 100.00% 13792.07 22 15493 13795.29 12985 14531 1031356 1516191 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11767 3.6% 24.6 16.47sec 212415 0 Direct 24.6 156615 313358 212397 35.6%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.61 24.61 0.00 0.00 0.0000 0.0000 5227839.92 7685419.88 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.85 64.40% 156614.63 122075 175482 156579.43 141694 168439 2482177 3649035 31.98
crit 8.76 35.60% 313357.73 244149 350964 313230.55 268564 350964 2745663 4036385 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 73454 22.6% 47.5 9.50sec 696075 692958 Direct 47.5 89164 178905 120770 35.2%  
Periodic 223.7 90021 180387 122101 35.5% 95.1%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.48 47.48 223.70 223.70 1.0045 1.9130 33049229.09 33049229.09 0.00 69483.41 692957.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.76 64.78% 89163.94 41423 216647 89192.99 75510 103519 2742346 2742346 0.00
crit 16.72 35.22% 178905.07 82845 433294 178928.39 141268 235395 2991981 2991981 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 144.3 64.50% 90020.57 39 216647 90034.08 80026 99282 12989177 12989177 0.00
crit 79.4 35.50% 180386.86 165 433294 180487.67 154225 206119 14325725 14325725 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 88100 27.2% 23.0 15.38sec 1720984 1713344 Periodic 327.3 89501 179043 121204 35.4% 96.4%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.05 0.00 327.25 327.25 1.0045 1.3260 39663905.43 39663905.43 0.00 86776.35 1713343.65
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 211.4 64.59% 89500.73 69 111506 89494.78 84026 93885 18919100 18919100 0.00
crit 115.9 35.41% 179042.59 137 223013 179048.25 167959 187781 20744806 20744806 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 31560 9.7% 112.8 3.98sec 125761 125199 Direct 112.8 92893 185816 125766 35.4%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.81 112.81 0.00 0.00 1.0045 0.0000 14187263.28 20856620.88 31.98 125198.67 125198.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.91 64.63% 92892.67 64908 139959 92903.30 86711 98677 6772500 9956217 31.98
crit 39.90 35.37% 185815.73 129817 279918 185763.74 167248 202937 7414763 10900404 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
instinct_865 / call_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_865 / call_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.02sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Cleansed Drake's Breath 4.3 77.35sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.26 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_865 / call_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_865 / call_865
  • harmful:false
  • if_expr:
 
Healing Touch 51.6 8.82sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 51.57 0.00 0.00 0.00 0.8447 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.8 24.46sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.77 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 132.77sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.59 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.34sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.19% 45.4(45.4) 15.1

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.1sec 182.1sec 9.80% 14.63% 0.0(0.0) 2.9

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Blood Frenzy 14.6 7.9 30.7sec 19.5sec 40.37% 40.44% 7.9(7.9) 14.2

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2902.15

Stack Uptimes

  • blood_frenzy_1:40.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 7.41% 0.0(0.0) 1.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 51.5 0.0 8.8sec 8.8sec 46.11% 46.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.58%
  • bloodtalons_2:27.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Cleansed Ancient's Blessing 3.9 0.3 88.6sec 80.2sec 8.95% 9.04% 0.3(0.3) 3.8

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_ancients_blessing_1:8.95%

Trigger Attempt Success

  • trigger_pct:98.42%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 4.0 0.3 87.2sec 79.0sec 9.17% 9.27% 0.3(0.3) 3.9

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_sisters_blessing_1:9.17%

Trigger Attempt Success

  • trigger_pct:99.16%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 3.9 0.3 88.5sec 80.0sec 8.86% 8.92% 0.3(0.3) 3.8

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_wisps_blessing_1:8.86%

Trigger Attempt Success

  • trigger_pct:98.56%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Clearcasting 44.7 1.6 9.9sec 9.6sec 6.66% 15.33% 1.6(1.6) 0.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.66%

Trigger Attempt Success

  • trigger_pct:8.73%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.9 63.7sec 48.0sec 24.66% 24.74% 1.9(1.9) 6.4

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 354.1sec 0.0sec 10.81% 10.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 51.3 1.1 8.8sec 8.6sec 74.44% 74.45% 1.1(1.1) 0.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.44%

Trigger Attempt Success

  • trigger_pct:98.71%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 7.6 11.1 50.6sec 24.4sec 94.12% 93.85% 202.5(202.5) 6.7

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:94.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 132.7sec 132.7sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.81% 29.03% 0.0(0.0) 15.0

Buff details

  • buff initial source:instinct_865 / call_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
instinct_865 / call_865
ferocious_bite Energy 22.5 386.0 17.1 34.3 8738.5
ferocious_bite Combo Points 11.3 52.8 4.7 4.7 63836.4
lunar_inspiration Energy 31.7 783.8 24.8 24.8 14253.0
rake Energy 47.5 1352.5 28.5 28.5 24435.1
rip Energy 23.0 465.6 20.2 20.2 85193.3
rip Combo Points 23.0 115.2 5.0 5.0 344203.7
savage_roar Energy 18.8 483.8 25.8 25.8 0.0
savage_roar Combo Points 18.8 93.8 5.0 5.0 0.0
shred Energy 112.8 3365.6 29.8 29.8 4215.4
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.48 47.48 (17.91%) 1.00 0.00 0.00%
tigers_fury Energy 15.21 912.32 (10.96%) 59.97 0.49 0.05%
ashamanes_frenzy Combo Points 6.12 18.37 (6.93%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.66 31.66 (11.94%) 1.00 0.00 0.00%
shred Combo Points 112.81 112.81 (42.54%) 1.00 0.00 0.00%
energy_regen Energy 2035.63 5230.65 (62.83%) 2.57 84.94 1.60%
clearcasting Energy 44.63 1521.04 (18.27%) 34.08 0.00 0.00%
ashamanes_energy Energy 45.44 661.52 (7.95%) 14.56 20.07 2.94%
primal_fury Combo Points 67.76 54.84 (20.68%) 0.81 12.92 19.06%
Resource RPS-Gain RPS-Loss
Energy 15.12 15.19
Combo Points 0.59 0.58
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 39.75 0.18 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.22 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.0%

Procs

Count Interval
clearcasting 46.3 9.6sec
clearcasting_wasted 1.6 115.3sec
primal_fury 67.8 6.6sec

Statistics & Data Analysis

Fight Length
Sample Data instinct_865 / call_865 Fight Length
Count 2499
Mean 450.05
Minimum 360.07
Maximum 539.96
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data instinct_865 / call_865 Damage Per Second
Count 2499
Mean 324617.30
Minimum 291928.77
Maximum 367996.70
Spread ( max - min ) 76067.93
Range [ ( max - min ) / 2 * 100% ] 11.72%
Standard Deviation 10497.5545
5th Percentile 307523.80
95th Percentile 342014.17
( 95th Percentile - 5th Percentile ) 34490.37
Mean Distribution
Standard Deviation 209.9931
95.00% Confidence Intervall ( 324205.72 - 325028.88 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4017
0.1 Scale Factor Error with Delta=300 940719
0.05 Scale Factor Error with Delta=300 3762876
0.01 Scale Factor Error with Delta=300 94071906
Priority Target DPS
Sample Data instinct_865 / call_865 Priority Target Damage Per Second
Count 2499
Mean 324617.30
Minimum 291928.77
Maximum 367996.70
Spread ( max - min ) 76067.93
Range [ ( max - min ) / 2 * 100% ] 11.72%
Standard Deviation 10497.5545
5th Percentile 307523.80
95th Percentile 342014.17
( 95th Percentile - 5th Percentile ) 34490.37
Mean Distribution
Standard Deviation 209.9931
95.00% Confidence Intervall ( 324205.72 - 325028.88 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4017
0.1 Scale Factor Error with Delta=300 940719
0.05 Scale Factor Error with Delta=300 3762876
0.01 Scale Factor Error with Delta=300 94071906
DPS(e)
Sample Data instinct_865 / call_865 Damage Per Second (Effective)
Count 2499
Mean 324617.30
Minimum 291928.77
Maximum 367996.70
Spread ( max - min ) 76067.93
Range [ ( max - min ) / 2 * 100% ] 11.72%
Damage
Sample Data instinct_865 / call_865 Damage
Count 2499
Mean 145999188.37
Minimum 108083047.45
Maximum 183911632.31
Spread ( max - min ) 75828584.86
Range [ ( max - min ) / 2 * 100% ] 25.97%
DTPS
Sample Data instinct_865 / call_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data instinct_865 / call_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data instinct_865 / call_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data instinct_865 / call_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data instinct_865 / call_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data instinct_865 / call_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data instinct_865 / call_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data instinct_865 / call_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.59 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.59 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.21 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 3.74 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 50.57 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 7.65 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 23.05 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 11.12 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 7.52 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.12 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.59 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.89 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.66 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 112.81 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQCAQIQQEMJQOPQQELOQQQEJQQPQQEIOQCQEJN89QQPEKQQQQOEJPOQQCQEJOPQQEKOQQPEJMOQCEJOPQEIQOQEJOPQQEKOQPCQEJOQQQQEJOPQEIOPCOQEJQQQQEJMOPEIOPCAN89QEJQQQEKQQQQEJOPQQELOPQCEJOQQQEIOPQQEJOQQQEKMCOPEJQQQELOPQQEJOQQEKOCPQEJQQQOEJOPQQEICN89QPQQEJQQEMKOPQEOQJPCQQEJOQQEIOPQDQQEOCABPQKQQQQDQOQELOPQELQQQQEKMCOPELOQQELOPQQEKOCN89PEDQQQPEKOQ

Sample Sequence Table

time name target resources buffs
Pre flask instinct_865 / call_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food instinct_865 / call_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation instinct_865 / call_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 76.2/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.009 shred Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:03.012 tigers_fury Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, cleansed_sisters_blessing, potion_of_the_old_war
0:03.012 berserk Fluffy_Pillow 95.4/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, tigers_fury, cleansed_sisters_blessing, potion_of_the_old_war
0:03.012 shred Fluffy_Pillow 95.4/150: 64% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, cleansed_sisters_blessing, potion_of_the_old_war
0:04.015 savage_roar Fluffy_Pillow 106.2/150: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, cleansed_sisters_blessing, potion_of_the_old_war
0:05.020 shred Fluffy_Pillow 117.0/150: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, potion_of_the_old_war
0:06.024 shred Fluffy_Pillow 127.8/150: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, potion_of_the_old_war
0:07.031 healing_touch Fluffy_Pillow 123.7/150: 82% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, potion_of_the_old_war
0:07.786 ashamanes_frenzy Fluffy_Pillow 135.6/150: 90% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, cleansed_sisters_blessing, potion_of_the_old_war
0:08.791 rip Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons, berserk, savage_roar, tigers_fury, cleansed_sisters_blessing, potion_of_the_old_war
0:09.796 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, potion_of_the_old_war
0:10.799 rake Fluffy_Pillow 145.8/150: 97% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing, potion_of_the_old_war
0:11.803 lunar_inspiration Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy, potion_of_the_old_war
0:12.807 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:13.811 shred Fluffy_Pillow 145.9/150: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:14.816 healing_touch Fluffy_Pillow 141.8/150: 95% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:15.569 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, blood_frenzy, potion_of_the_old_war
0:16.574 rake Fluffy_Pillow 140.9/150: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:17.580 shred Fluffy_Pillow 139.4/150: 93% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:18.583 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:19.586 shred Fluffy_Pillow 75.9/100: 76% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:20.591 healing_touch Fluffy_Pillow 51.8/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:21.350 Waiting 0.100 sec 63.8/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, potion_of_the_old_war
0:21.450 rip Fluffy_Pillow 65.2/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, potion_of_the_old_war
0:22.457 shred Fluffy_Pillow 79.4/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.460 shred Fluffy_Pillow 53.5/100: 54% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.466 Waiting 0.400 sec 27.7/100: 28% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.866 lunar_inspiration Fluffy_Pillow 33.4/100: 33% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:25.870 Waiting 1.627 sec 17.6/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:27.497 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:28.503 shred Fluffy_Pillow 14.7/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, predatory_swiftness
0:29.506 healing_touch Fluffy_Pillow 28.8/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness
0:30.515 savage_roar Fluffy_Pillow 43.1/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2)
0:31.520 rake Fluffy_Pillow 57.3/100: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:32.525 Waiting 0.300 sec 36.4/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:32.825 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:33.830 tigers_fury Fluffy_Pillow 14.9/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:33.830 shred Fluffy_Pillow 74.9/100: 75% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.834 healing_touch Fluffy_Pillow 65.8/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:35.588 rip Fluffy_Pillow 77.7/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
0:36.593 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:36.593 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:36.593 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:37.596 shred Fluffy_Pillow 95.9/100: 96% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:38.599 shred Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:39.604 lunar_inspiration Fluffy_Pillow 47.7/100: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:40.609 healing_touch Fluffy_Pillow 33.7/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
0:41.474 Waiting 3.900 sec 44.2/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy, jacins_ruse
0:45.374 savage_roar Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
0:46.378 shred Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
0:47.382 shred Fluffy_Pillow 71.5/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:48.386 shred Fluffy_Pillow 42.4/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
0:49.390 shred Fluffy_Pillow 53.3/100: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:51.420 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:52.422 healing_touch Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
0:53.348 rip Fluffy_Pillow 21.2/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
0:54.353 lunar_inspiration Fluffy_Pillow 32.1/100: 32% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:57.400 rake Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:58.404 Waiting 1.681 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:00.085 shred Fluffy_Pillow 29.5/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:01.088 shred Fluffy_Pillow 41.7/100: 42% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:02.094 Waiting 1.506 sec 13.9/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:03.600 tigers_fury Fluffy_Pillow 32.3/100: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:03.830 shred Fluffy_Pillow 95.1/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:04.834 healing_touch Fluffy_Pillow 82.4/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:05.658 rip Fluffy_Pillow 92.4/100: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:06.663 rake Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:07.666 lunar_inspiration Fluffy_Pillow 81.9/100: 82% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:08.670 shred Fluffy_Pillow 64.1/100: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:09.674 Waiting 0.300 sec 36.4/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:09.974 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:10.979 healing_touch Fluffy_Pillow 11.0/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:11.904 Waiting 0.969 sec 21.0/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:12.873 savage_roar Fluffy_Pillow 31.5/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:13.878 rake Fluffy_Pillow 42.4/100: 42% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:14.882 Waiting 2.016 sec 18.3/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:16.898 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:17.902 Waiting 2.682 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:20.584 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:21.588 Waiting 1.781 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:23.369 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:24.373 healing_touch Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:25.299 Waiting 0.835 sec 21.4/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:26.134 rip Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:27.139 ashamanes_frenzy Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:29.420 rake Fluffy_Pillow 36.5/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:30.425 Waiting 2.225 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:32.650 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:33.654 tigers_fury Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:33.830 healing_touch Fluffy_Pillow 75.2/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:34.655 Waiting 0.200 sec 85.3/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
1:34.855 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
1:35.861 rake Fluffy_Pillow 97.3/100: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:36.866 lunar_inspiration Fluffy_Pillow 89.5/100: 90% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:37.872 shred Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:38.878 healing_touch Fluffy_Pillow 44.0/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:39.703 Waiting 0.900 sec 54.1/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:40.603 savage_roar Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, blood_frenzy, jacins_ruse
1:41.608 shred Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
1:42.611 rake Fluffy_Pillow 49.6/100: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:43.615 shred Fluffy_Pillow 61.8/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
1:44.619 healing_touch Fluffy_Pillow 34.0/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
1:45.443 Waiting 3.000 sec 44.1/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
1:48.443 rip Fluffy_Pillow 80.7/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
1:49.447 rake Fluffy_Pillow 92.9/100: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, jacins_ruse
1:50.453 lunar_inspiration Fluffy_Pillow 69.3/100: 69% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:51.458 shred Fluffy_Pillow 50.2/100: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:52.465 shred Fluffy_Pillow 21.1/100: 21% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
1:53.470 healing_touch Fluffy_Pillow 32.1/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:54.395 Waiting 4.400 sec 42.1/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:58.795 savage_roar Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:59.799 rake Fluffy_Pillow 60.7/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:00.804 Waiting 0.400 sec 36.6/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:01.204 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:02.208 Waiting 1.308 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:03.516 lunar_inspiration Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
2:04.520 tigers_fury Fluffy_Pillow 37.0/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:04.520 shred Fluffy_Pillow 97.0/100: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:05.524 healing_touch Fluffy_Pillow 82.9/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:06.450 rip Fluffy_Pillow 92.9/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:07.455 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:08.462 shred Fluffy_Pillow 90.9/100: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
2:09.467 shred Fluffy_Pillow 61.8/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:10.472 Waiting 0.600 sec 33.4/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:11.072 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:12.077 Waiting 2.303 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:14.380 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:15.385 healing_touch Fluffy_Pillow 12.9/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:16.214 Waiting 2.870 sec 22.9/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
2:19.084 rip Fluffy_Pillow 57.7/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
2:20.090 rake Fluffy_Pillow 39.7/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:21.095 Waiting 1.367 sec 15.6/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:22.462 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:23.468 shred Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
2:24.474 healing_touch Fluffy_Pillow 22.3/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:25.399 Waiting 3.300 sec 32.3/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:28.699 savage_roar Fluffy_Pillow 68.1/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
2:29.704 rake Fluffy_Pillow 39.0/100: 39% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:30.709 Waiting 1.628 sec 14.9/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:32.337 lunar_inspiration Fluffy_Pillow 32.6/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:33.340 Waiting 1.061 sec 13.5/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:34.401 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:34.520 rake Fluffy_Pillow 86.3/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:35.525 shred Fluffy_Pillow 77.2/100: 77% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:36.530 healing_touch Fluffy_Pillow 63.1/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:37.435 Waiting 0.100 sec 73.1/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
2:37.535 rip Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
2:38.542 shred Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:39.547 shred Fluffy_Pillow 43.9/100: 44% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:40.550 Waiting 2.029 sec 16.1/100: 16% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:42.579 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:43.583 Waiting 2.277 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:45.860 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:46.865 healing_touch Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:47.709 Waiting 0.670 sec 23.2/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:48.379 rip Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:49.384 ashamanes_frenzy Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:51.667 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:52.672 Waiting 1.696 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:54.368 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
2:55.371 healing_touch Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
2:58.084 savage_roar Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
3:01.378 rake Fluffy_Pillow 36.5/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:02.381 Waiting 1.862 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:04.243 lunar_inspiration Fluffy_Pillow 33.4/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
3:05.248 tigers_fury Fluffy_Pillow 15.6/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
3:05.248 berserk Fluffy_Pillow 75.6/100: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:05.248 shadowmeld Fluffy_Pillow 75.6/150: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:05.248 rake Fluffy_Pillow 75.6/150: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points shadowmeld, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:05.248 auto_attack Fluffy_Pillow 58.1/150: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:06.251 shred Fluffy_Pillow 85.4/150: 57% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:07.255 healing_touch Fluffy_Pillow 92.6/150: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:08.080 rip Fluffy_Pillow 102.7/150: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, blood_frenzy
3:09.085 shred Fluffy_Pillow 129.9/150: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:10.091 shred Fluffy_Pillow 122.2/150: 81% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:11.095 shred Fluffy_Pillow 114.4/150: 76% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:12.100 healing_touch Fluffy_Pillow 106.7/150: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:12.923 savage_roar Fluffy_Pillow 116.7/150: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, blood_frenzy
3:13.927 shred Fluffy_Pillow 108.6/150: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar
3:14.932 shred Fluffy_Pillow 99.5/150: 66% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:15.936 shred Fluffy_Pillow 90.4/150: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, berserk, predatory_swiftness, savage_roar
3:16.940 shred Fluffy_Pillow 101.3/150: 68% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar
3:17.945 healing_touch Fluffy_Pillow 92.2/150: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse
3:18.871 rip Fluffy_Pillow 102.2/150: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, jacins_ruse
3:19.876 rake Fluffy_Pillow 98.1/150: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse
3:20.881 lunar_inspiration Fluffy_Pillow 91.6/100: 92% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
3:21.885 shred Fluffy_Pillow 72.4/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
3:22.891 shred Fluffy_Pillow 43.4/100: 43% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
3:23.896 healing_touch Fluffy_Pillow 14.3/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
3:24.822 Waiting 6.000 sec 24.3/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing, jacins_ruse
3:30.822 ferocious_bite Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
3:31.828 rake Fluffy_Pillow 75.4/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:32.833 lunar_inspiration Fluffy_Pillow 51.3/100: 51% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:33.838 Waiting 0.800 sec 32.2/100: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:34.638 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:35.643 tigers_fury Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:35.643 healing_touch Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:36.568 Waiting 0.100 sec 81.8/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
3:36.668 rip Fluffy_Pillow 97.9/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
3:37.672 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:38.676 shred Fluffy_Pillow 90.9/100: 91% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
3:39.681 shred Fluffy_Pillow 61.8/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
3:40.684 Waiting 0.700 sec 32.7/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
3:41.384 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
3:42.387 healing_touch Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
3:43.312 Waiting 0.849 sec 21.2/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
3:44.930 savage_roar Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), cleansed_sisters_blessing
3:46.446 rake Fluffy_Pillow 18.5/100: 18% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:47.451 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:48.456 Waiting 2.006 sec 12.8/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:50.462 shred Fluffy_Pillow 37.1/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:51.466 shred Fluffy_Pillow 49.3/100: 49% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
3:52.470 healing_touch Fluffy_Pillow 22.0/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
3:53.224 Waiting 0.400 sec 32.1/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_sisters_blessing, blood_frenzy
3:53.624 rip Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_sisters_blessing, blood_frenzy
3:54.629 rake Fluffy_Pillow 51.0/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
3:55.633 Waiting 0.800 sec 29.5/100: 29% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
3:56.433 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
3:57.436 shred Fluffy_Pillow 13.4/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
3:58.440 Waiting 1.200 sec 25.6/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:59.640 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:00.644 healing_touch Fluffy_Pillow 12.5/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:01.468 Waiting 1.601 sec 22.5/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
4:03.069 savage_roar Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:04.327 ashamanes_frenzy Fluffy_Pillow 14.4/100: 14% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:05.646 tigers_fury Fluffy_Pillow 28.7/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
4:05.646 rake Fluffy_Pillow 88.7/100: 89% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:06.650 lunar_inspiration Fluffy_Pillow 79.6/100: 80% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:07.653 healing_touch Fluffy_Pillow 75.5/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:08.578 Waiting 0.100 sec 85.5/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:08.678 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
4:09.683 shred Fluffy_Pillow 82.3/100: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:10.689 shred Fluffy_Pillow 54.5/100: 55% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:11.694 Waiting 0.300 sec 26.8/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:11.994 shred Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:12.999 healing_touch Fluffy_Pillow 42.7/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:13.824 Waiting 2.900 sec 52.7/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
4:16.724 ferocious_bite Fluffy_Pillow 88.1/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
4:17.727 rake Fluffy_Pillow 50.3/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:18.733 Waiting 0.200 sec 27.6/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:18.933 lunar_inspiration Fluffy_Pillow 30.0/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:19.939 Waiting 1.689 sec 13.0/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
4:21.628 shred Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
4:22.633 shred Fluffy_Pillow 49.3/100: 49% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
4:23.637 healing_touch Fluffy_Pillow 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy
4:24.391 Waiting 1.900 sec 32.9/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, blood_frenzy
4:26.291 rip Fluffy_Pillow 58.5/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_sisters_blessing, blood_frenzy, jacins_ruse
4:27.294 rake Fluffy_Pillow 71.9/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy, jacins_ruse
4:28.298 shred Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy, jacins_ruse
4:29.302 shred Fluffy_Pillow 63.9/100: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, blood_frenzy, jacins_ruse
4:30.306 healing_touch Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:31.131 Waiting 1.600 sec 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
4:32.731 savage_roar Fluffy_Pillow 65.8/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
4:33.736 rake Fluffy_Pillow 38.1/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:34.740 Waiting 1.011 sec 14.0/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:35.751 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:35.751 lunar_inspiration Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:36.756 shred Fluffy_Pillow 80.9/100: 81% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:37.761 healing_touch Fluffy_Pillow 66.8/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:38.687 Waiting 0.100 sec 76.9/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
4:38.787 rip Fluffy_Pillow 92.9/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
4:39.792 shred Fluffy_Pillow 73.8/100: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:40.795 shred Fluffy_Pillow 44.7/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:41.799 Waiting 2.263 sec 15.6/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
4:44.062 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
4:45.065 Waiting 1.783 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
4:47.358 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:48.363 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:49.287 Waiting 6.286 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
4:55.573 rip Fluffy_Pillow 90.1/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:56.578 rake Fluffy_Pillow 71.0/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:57.583 lunar_inspiration Fluffy_Pillow 46.9/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness
4:58.589 Waiting 1.000 sec 29.1/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, cleansed_sisters_blessing
4:59.589 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, cleansed_sisters_blessing
5:00.593 Waiting 0.963 sec 13.3/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, cleansed_sisters_blessing
5:01.556 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, cleansed_sisters_blessing
5:02.562 healing_touch Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, cleansed_sisters_blessing
5:03.390 savage_roar Fluffy_Pillow 47.2/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), cleansed_sisters_blessing
5:05.673 tigers_fury Fluffy_Pillow 34.8/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_sisters_blessing
5:05.751 shadowmeld Fluffy_Pillow 95.8/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
5:05.751 rake Fluffy_Pillow 95.8/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
5:05.751 auto_attack Fluffy_Pillow 60.8/100: 61% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
5:06.755 shred Fluffy_Pillow 87.9/100: 88% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
5:07.759 lunar_inspiration Fluffy_Pillow 74.9/100: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:08.764 shred Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:09.767 shred Fluffy_Pillow 41.7/100: 42% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
5:10.773 healing_touch Fluffy_Pillow 52.6/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:11.699 Waiting 2.500 sec 62.7/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:14.199 rip Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:15.204 shred Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:16.209 shred Fluffy_Pillow 41.6/100: 42% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:17.213 Waiting 1.149 sec 12.5/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:18.619 healing_touch Fluffy_Pillow 27.8/100: 28% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:19.544 ashamanes_frenzy Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar
5:20.549 savage_roar Fluffy_Pillow 49.8/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, blood_frenzy
5:22.830 rake Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:23.834 Waiting 1.332 sec 14.9/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:25.166 lunar_inspiration Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:26.170 Waiting 2.256 sec 13.3/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:28.426 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:29.431 Waiting 1.676 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:31.107 healing_touch Fluffy_Pillow 33.5/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:31.931 rake Fluffy_Pillow 43.6/100: 44% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:32.936 Waiting 0.442 sec 20.8/100: 21% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar, blood_frenzy
5:33.378 shred Fluffy_Pillow 26.2/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons, savage_roar, blood_frenzy
5:34.382 rip Fluffy_Pillow 38.5/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, savage_roar, blood_frenzy
5:35.385 lunar_inspiration Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:36.389 tigers_fury Fluffy_Pillow 32.9/100: 33% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:36.389 shred Fluffy_Pillow 92.9/100: 93% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:37.393 shred Fluffy_Pillow 80.2/100: 80% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:38.398 healing_touch Fluffy_Pillow 66.3/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:39.324 Waiting 0.100 sec 76.4/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:39.424 rip Fluffy_Pillow 92.5/100: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:40.428 rake Fluffy_Pillow 73.4/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:41.434 shred Fluffy_Pillow 49.3/100: 49% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
5:42.438 Waiting 1.844 sec 20.2/100: 20% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:44.282 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:45.287 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:46.158 Waiting 5.314 sec 21.2/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:51.472 savage_roar Fluffy_Pillow 86.0/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), cleansed_ancients_blessing, blood_frenzy
5:52.477 rake Fluffy_Pillow 58.2/100: 58% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy
5:53.481 lunar_inspiration Fluffy_Pillow 35.5/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy
5:54.486 shred Fluffy_Pillow 47.7/100: 48% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy
5:55.492 Waiting 1.912 sec 20.0/100: 20% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy
5:57.404 ferocious_bite Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:58.409 Waiting 1.798 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
6:00.207 shred Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar
6:01.211 shred Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:02.214 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:04.421 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar
6:05.425 Waiting 0.985 sec 13.0/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, savage_roar, blood_frenzy
6:06.410 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, savage_roar, blood_frenzy
6:06.410 berserk Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
6:06.410 potion Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, blood_frenzy
6:06.410 lunar_inspiration Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:07.415 shred Fluffy_Pillow 97.2/150: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:08.421 savage_roar Fluffy_Pillow 104.5/150: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, berserk, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:09.425 shred Fluffy_Pillow 131.8/150: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:10.429 shred Fluffy_Pillow 124.0/150: 83% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:11.434 shred Fluffy_Pillow 116.2/150: 77% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:12.438 shred Fluffy_Pillow 108.5/150: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:13.445 ferocious_bite Fluffy_Pillow 100.8/150: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:14.448 shred Fluffy_Pillow 88.0/150: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:15.452 rake Fluffy_Pillow 99.3/150: 66% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:16.457 shred Fluffy_Pillow 92.7/150: 62% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:17.462 healing_touch Fluffy_Pillow 83.6/150: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:18.387 ferocious_bite Fluffy_Pillow 93.6/150: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:19.390 rake Fluffy_Pillow 79.5/150: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:20.394 lunar_inspiration Fluffy_Pillow 72.9/150: 49% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, potion_of_the_old_war
6:21.398 shred Fluffy_Pillow 83.8/150: 56% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, cleansed_ancients_blessing, potion_of_the_old_war
6:22.401 healing_touch Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
6:23.225 Waiting 0.200 sec 86.1/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
6:23.425 ferocious_bite Fluffy_Pillow 88.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
6:24.430 shred Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
6:25.434 shred Fluffy_Pillow 23.0/100: 23% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
6:26.438 Waiting 0.400 sec 35.2/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
6:26.838 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
6:27.842 Waiting 2.337 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, blood_frenzy, potion_of_the_old_war
6:30.179 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:31.184 healing_touch Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:32.082 Waiting 1.571 sec 23.1/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:33.653 savage_roar Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:34.657 ashamanes_frenzy Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:36.171 tigers_fury Fluffy_Pillow 27.5/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
6:36.410 rake Fluffy_Pillow 90.1/100: 90% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:37.414 lunar_inspiration Fluffy_Pillow 81.0/100: 81% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:38.418 healing_touch Fluffy_Pillow 76.9/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:39.343 Waiting 0.100 sec 86.9/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:39.443 ferocious_bite Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
6:40.447 rake Fluffy_Pillow 85.9/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
6:41.453 shred Fluffy_Pillow 61.8/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
6:42.457 Waiting 0.700 sec 32.7/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
6:43.157 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
6:44.161 healing_touch Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
6:45.088 Waiting 5.744 sec 21.3/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:50.832 ferocious_bite Fluffy_Pillow 88.2/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
6:51.837 rake Fluffy_Pillow 75.5/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
6:52.842 lunar_inspiration Fluffy_Pillow 52.7/100: 53% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:53.847 Waiting 0.500 sec 35.0/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:54.347 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:55.350 Waiting 2.260 sec 13.3/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:57.610 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:58.614 healing_touch Fluffy_Pillow 11.4/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:59.541 Waiting 2.521 sec 21.5/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:02.062 savage_roar Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
7:04.089 rake Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
7:05.094 Waiting 1.133 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
7:06.227 tigers_fury Fluffy_Pillow 26.2/100: 26% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
7:06.410 shadowmeld Fluffy_Pillow 88.4/100: 88% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
7:06.410 rake Fluffy_Pillow 88.4/100: 88% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
7:06.410 auto_attack Fluffy_Pillow 53.4/100: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
7:07.415 lunar_inspiration Fluffy_Pillow 80.7/100: 81% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
7:08.420 healing_touch Fluffy_Pillow 77.9/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
7:09.245 ferocious_bite Fluffy_Pillow 88.0/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
7:10.250 shred Fluffy_Pillow 65.3/100: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
7:11.255 Waiting 0.300 sec 37.0/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
7:11.555 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
7:12.560 Waiting 2.672 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
7:15.232 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:16.238 Waiting 1.779 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:18.017 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:19.022 healing_touch Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:19.948 Waiting 1.734 sec 21.4/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:21.682 savage_roar Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:24.985 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
7:25.989 Waiting 2.603 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
7:28.592 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
7:29.597 Waiting 1.281 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 23138 21431 11378 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 27766 25717 0
Crit 34.71% 34.71% 6549
Haste 8.53% 8.53% 2771
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 23138 21431 0
Mastery 53.58% 51.42% 6200
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 847.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Bloodthirsty Instinct
ilevel: 865, stats: { +1418 Agi }
Local Trinket2 Nature's Call
ilevel: 865, stats: { +329 Mastery, +329 Haste, +329 Crit }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="instinct_865 / call_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1805
trinket2=natures_call,id=139334,bonus_id=1805
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=846.88
# gear_agility=11378
# gear_stamina=17628
# gear_crit_rating=6549
# gear_haste_rating=1847
# gear_mastery_rating=6200
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

instinct_865 / pod_865 : 323724 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
323723.9 323723.9 396.4 / 0.122% 39592.5 / 12.2% 21042.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
15.4 15.4 Energy 29.77% 45.3 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
instinct_865 / pod_865 323724
Ashamane's Frenzy 14883 4.6% 6.1 78.41sec 1093042 1088255 Direct 91.7 10178 20356 13619 33.8%  
Periodic 30.3 134592 269390 179817 33.6% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.13 91.67 121.96 30.29 1.0045 0.6471 6696031.54 7282929.54 8.06 78705.54 1088254.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.67 66.19% 10177.99 7568 12108 10180.98 9041 11368 617551 907859 31.98
crit 30.99 33.81% 20355.59 15135 24215 20357.92 17840 23254 630916 927507 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.1 66.45% 134592.48 83438 166868 134641.95 120778 153337 2709487 2709487 0.00
crit 10.2 33.55% 269389.66 166876 333736 269441.70 221742 315226 2738077 2738077 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 38058 11.8% 19.1 21.92sec 898461 0 Periodic 150.3 85286 170722 114053 33.7% 43.1%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.07 0.00 150.26 150.26 0.0000 1.2903 17137982.04 17137982.04 0.00 88393.42 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.7 66.33% 85285.82 59 101078 85197.80 73717 92805 8499676 8499676 0.00
crit 50.6 33.67% 170721.67 118 202156 170492.99 146932 186867 8638306 8638306 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 30634 9.5% 538.9 0.83sec 25575 30758 Direct 538.9 19131 38262 25575 33.7%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 538.85 538.85 0.00 0.00 0.8315 0.0000 13781214.20 20259690.27 31.98 30757.52 30757.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 357.34 66.31% 19130.53 14889 21403 19130.55 18680 19473 6836112 10049732 31.98
crit 181.51 33.69% 38262.27 29778 42805 38261.36 37355 39097 6945102 10209958 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 7534 2.3% 11.4 41.04sec 296955 295637 Direct 11.4 210167 465819 296932 34.0%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.40 11.40 0.00 0.00 1.0045 0.0000 3385925.40 4977631.07 31.98 295636.55 295636.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.53 66.05% 210167.37 16253 268499 210093.48 110988 256826 1582651 2326647 31.98
crit 3.87 33.95% 465819.08 34690 593384 461038.97 0 593384 1803274 2650984 31.61
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Infested Ground 5286 1.6% 7.9 60.70sec 302741 0 Direct 77.6 22882 45755 30641 33.9%  

Stats details: infested_ground

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.85 77.59 0.00 0.00 0.0000 0.0000 2377471.65 2377471.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.26 66.07% 22881.60 16725 24042 22882.41 21867 23520 1172965 1172965 0.00
crit 26.32 33.93% 45755.46 33450 48085 45755.85 42893 47736 1204507 1204507 0.00
 
 

Action details: infested_ground

Static Values
  • id:221803
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221803
  • name:Infested Ground
  • school:shadow
  • tooltip:
  • description:Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.
 
Moonfire (lunar_inspiration) 24936 7.7% 31.7 14.28sec 353690 352112 Direct 31.7 35349 70722 47378 34.0%  
Periodic 266.6 27240 54438 36449 33.9% 97.2%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.72 31.72 266.59 266.59 1.0045 1.6409 11219702.79 11219702.79 0.00 23907.47 352112.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.93 65.99% 35349.02 27496 39526 35351.16 32995 37146 739950 739950 0.00
crit 10.79 34.01% 70721.77 54992 79051 70718.80 64321 76760 763034 763034 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 176.3 66.14% 27240.25 100 30743 27240.17 26060 27837 4803258 4803258 0.00
crit 90.3 33.86% 54437.92 149 61485 54437.29 51331 56673 4913461 4913461 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2320 0.7% 25.6 17.45sec 40776 0 Periodic 75.7 13789 0 13789 0.0% 8.4%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.60 0.00 75.70 75.70 0.0000 0.4970 1043829.26 1534527.89 31.98 27746.66 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.7 100.00% 13788.93 27 15493 13790.56 12948 14497 1043829 1534528 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11817 3.6% 25.1 16.16sec 209469 0 Direct 25.1 156736 313395 209465 33.7%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.06 25.06 0.00 0.00 0.0000 0.0000 5248799.96 7716233.12 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.62 66.34% 156736.22 122075 175482 156698.04 144010 167159 2605388 3830167 31.98
crit 8.43 33.66% 313395.44 244149 350964 313305.02 264495 350964 2643412 3886066 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 71045 22.0% 47.5 9.50sec 672749 669736 Direct 47.5 87538 174421 116886 33.8%  
Periodic 223.7 88285 176533 118073 33.8% 95.1%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.52 47.52 223.69 223.69 1.0045 1.9142 31966499.78 31966499.78 0.00 67169.21 669736.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.47 66.22% 87538.20 40916 196385 87565.98 74609 100214 2754547 2754547 0.00
crit 16.05 33.78% 174421.43 81831 392770 174516.34 139155 223908 2799404 2799404 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.2 66.24% 88285.24 39 196385 88309.12 79090 96740 13082121 13082121 0.00
crit 75.5 33.76% 176533.48 85 392770 176533.17 139991 208011 13330428 13330428 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 85418 26.4% 23.1 15.25sec 1666611 1659206 Periodic 327.5 87732 175492 117425 33.8% 96.5%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.07 0.00 327.46 327.46 1.0045 1.3260 38452103.01 38452103.01 0.00 84067.79 1659206.17
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 216.7 66.17% 87732.09 59 101078 87727.89 82638 91781 19008379 19008379 0.00
crit 110.8 33.83% 175491.86 136 202156 175485.15 164564 184089 19443724 19443724 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 31792 9.8% 115.2 3.90sec 124109 123553 Direct 115.2 92735 185538 124112 33.8%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.16 115.16 0.00 0.00 1.0045 0.0000 14292600.44 21011476.47 31.98 123552.91 123552.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.23 66.19% 92734.74 64908 139959 92749.25 87870 98282 7069040 10392158 31.98
crit 38.93 33.81% 185537.94 129817 279918 185489.37 170084 205195 7223561 10619319 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
instinct_865 / pod_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_865 / pod_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.06sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_865 / pod_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:instinct_865 / pod_865
  • harmful:false
  • if_expr:
 
Healing Touch 51.7 8.79sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 51.74 0.00 0.00 0.00 0.8320 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.8 24.40sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.78 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.39sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.35sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.10% 10.17% 45.4(45.4) 15.1

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.1sec 182.1sec 9.78% 14.47% 0.0(0.0) 2.9

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Blood Frenzy 14.7 7.7 30.6sec 19.6sec 40.33% 40.40% 7.7(7.7) 14.2

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2902.15

Stack Uptimes

  • blood_frenzy_1:40.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 7.93% 0.0(0.0) 1.0

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 51.7 0.0 8.8sec 8.8sec 45.60% 45.64% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.41%
  • bloodtalons_2:27.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 45.3 1.6 9.8sec 9.4sec 6.71% 15.37% 1.6(1.6) 0.0

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.71%

Trigger Attempt Success

  • trigger_pct:8.71%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.7 1.8 63.8sec 48.5sec 24.70% 24.78% 1.8(1.8) 6.4

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Leeching Pestilence 7.9 0.0 60.7sec 60.7sec 17.27% 17.35% 0.0(0.0) 7.7

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_leeching_pestilence
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:leech_rating
  • amount:1771.29

Stack Uptimes

  • leeching_pestilence_1:17.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221805
  • name:Leeching Pestilence
  • tooltip:Leech increased by $w1.
  • description:{$@spelldesc221803=Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.4sec 0.0sec 10.81% 10.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 51.4 1.1 8.7sec 8.5sec 74.73% 74.75% 1.1(1.1) 0.0

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.73%

Trigger Attempt Success

  • trigger_pct:98.75%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 7.5 11.3 51.4sec 24.4sec 94.19% 93.95% 201.4(201.4) 6.5

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:94.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.0sec 133.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.78% 28.95% 0.0(0.0) 14.9

Buff details

  • buff initial source:instinct_865 / pod_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
instinct_865 / pod_865
ferocious_bite Energy 22.8 393.7 17.3 34.5 8601.0
ferocious_bite Combo Points 11.4 53.6 4.7 4.7 63137.9
lunar_inspiration Energy 31.7 785.4 24.8 24.8 14286.1
rake Energy 47.5 1355.8 28.5 28.5 23577.6
rip Energy 23.1 465.6 20.2 20.2 82582.0
rip Combo Points 23.1 115.4 5.0 5.0 333323.5
savage_roar Energy 18.8 482.6 25.7 25.7 0.0
savage_roar Combo Points 18.8 93.9 5.0 5.0 0.0
shred Energy 115.2 3436.5 29.8 29.8 4159.0
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.52 47.52 (17.86%) 1.00 0.00 0.00%
tigers_fury Energy 15.20 911.19 (10.80%) 59.96 0.56 0.06%
ashamanes_frenzy Combo Points 6.13 18.38 (6.91%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.72 31.72 (11.92%) 1.00 0.00 0.00%
shred Combo Points 115.16 115.16 (43.28%) 1.00 0.00 0.00%
energy_regen Energy 2115.68 5316.23 (63.03%) 2.51 85.58 1.58%
clearcasting Energy 45.25 1547.03 (18.34%) 34.19 0.00 0.00%
ashamanes_energy Energy 45.39 659.62 (7.82%) 14.53 21.29 3.13%
primal_fury Combo Points 65.78 53.29 (20.03%) 0.81 12.48 18.98%
Resource RPS-Gain RPS-Loss
Energy 15.30 15.38
Combo Points 0.59 0.58
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 38.61 0.34 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.20 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.9%

Procs

Count Interval
clearcasting 46.9 9.4sec
clearcasting_wasted 1.6 119.0sec
primal_fury 65.8 6.8sec

Statistics & Data Analysis

Fight Length
Sample Data instinct_865 / pod_865 Fight Length
Count 2499
Mean 450.05
Minimum 360.07
Maximum 539.96
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data instinct_865 / pod_865 Damage Per Second
Count 2499
Mean 323723.87
Minimum 292828.18
Maximum 357352.57
Spread ( max - min ) 64524.38
Range [ ( max - min ) / 2 * 100% ] 9.97%
Standard Deviation 10110.3644
5th Percentile 307570.23
95th Percentile 340330.01
( 95th Percentile - 5th Percentile ) 32759.77
Mean Distribution
Standard Deviation 202.2477
95.00% Confidence Intervall ( 323327.47 - 324120.27 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3746
0.1 Scale Factor Error with Delta=300 872604
0.05 Scale Factor Error with Delta=300 3490416
0.01 Scale Factor Error with Delta=300 87260417
Priority Target DPS
Sample Data instinct_865 / pod_865 Priority Target Damage Per Second
Count 2499
Mean 323723.87
Minimum 292828.18
Maximum 357352.57
Spread ( max - min ) 64524.38
Range [ ( max - min ) / 2 * 100% ] 9.97%
Standard Deviation 10110.3644
5th Percentile 307570.23
95th Percentile 340330.01
( 95th Percentile - 5th Percentile ) 32759.77
Mean Distribution
Standard Deviation 202.2477
95.00% Confidence Intervall ( 323327.47 - 324120.27 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3746
0.1 Scale Factor Error with Delta=300 872604
0.05 Scale Factor Error with Delta=300 3490416
0.01 Scale Factor Error with Delta=300 87260417
DPS(e)
Sample Data instinct_865 / pod_865 Damage Per Second (Effective)
Count 2499
Mean 323723.87
Minimum 292828.18
Maximum 357352.57
Spread ( max - min ) 64524.38
Range [ ( max - min ) / 2 * 100% ] 9.97%
Damage
Sample Data instinct_865 / pod_865 Damage
Count 2499
Mean 145602160.06
Minimum 109192116.24
Maximum 186411833.85
Spread ( max - min ) 77219717.60
Range [ ( max - min ) / 2 * 100% ] 26.52%
DTPS
Sample Data instinct_865 / pod_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data instinct_865 / pod_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data instinct_865 / pod_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data instinct_865 / pod_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data instinct_865 / pod_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data instinct_865 / pod_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data instinct_865 / pod_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data instinct_865 / pod_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.57 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.57 auto_attack
0.00 skull_bash
A 2.95 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 7.85 use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
C 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
D 15.20 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
E 3.68 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
F 50.74 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
J 7.52 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
K 23.07 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
L 11.26 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
M 7.73 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
N 6.13 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
O 3.57 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
P 42.94 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
Q 31.72 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
R 115.16 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789QRDABRJRFNKRRPFMQPRRFKRRRRRFLPQRDRFKO89RRRRFLQRRFKPRQFMPDBRRRFKPQRRFJNPFKPQRRFMDPRRFKPQRRFJPQRRRFKPRDBRFKPQRRFLPRRQFKPRRRDFPKQRRFJNPRFKPQRRFPDABKQRRRFJO89RRRFMRQRFKRRPRFLPDQRRFKPRRRQFKPRRFJNPFMDBQPRRFKPRQRFJPQPFKRDRRFKPRQRRFJPRRFKPQRRFLDBPRRFKNQRFMPRRQFKPRRDRFJO89QRFERPRFLPQERDABCRRFPQKRRRRFLPRRRFMPQRRFMNRRFLPDQRRFMPRRQRFLPREQRFPDBRMRRRRFLPQ

Sample Sequence Table

time name target resources buffs
Pre flask instinct_865 / pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food instinct_865 / pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation instinct_865 / pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, jacins_ruse, potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, jacins_ruse, potion_of_the_old_war
0:02.009 shred Fluffy_Pillow 61.1/100: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, jacins_ruse, potion_of_the_old_war
0:03.014 tigers_fury Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, jacins_ruse, potion_of_the_old_war
0:03.014 berserk Fluffy_Pillow 95.7/100: 96% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, tigers_fury, jacins_ruse, potion_of_the_old_war
0:03.014 use_item_ravaged_seed_pod Fluffy_Pillow 95.7/150: 64% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, jacins_ruse, potion_of_the_old_war
0:03.014 shred Fluffy_Pillow 95.7/150: 64% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:04.019 savage_roar Fluffy_Pillow 105.3/150: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:05.022 shred Fluffy_Pillow 114.8/150: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:06.027 healing_touch Fluffy_Pillow 124.4/150: 83% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:06.782 ashamanes_frenzy Fluffy_Pillow 135.4/150: 90% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:07.787 rip Fluffy_Pillow 149.9/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:08.791 shred Fluffy_Pillow 149.5/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:09.796 shred Fluffy_Pillow 144.1/150: 96% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:10.802 rake Fluffy_Pillow 138.7/150: 92% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:11.804 healing_touch Fluffy_Pillow 135.7/150: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:12.560 ferocious_bite Fluffy_Pillow 146.7/150: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, leeching_pestilence, jacins_ruse, potion_of_the_old_war
0:13.564 lunar_inspiration Fluffy_Pillow 136.2/150: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:14.569 rake Fluffy_Pillow 135.8/150: 91% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:15.572 shred Fluffy_Pillow 132.8/150: 89% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.577 shred Fluffy_Pillow 127.4/150: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.580 healing_touch Fluffy_Pillow 122.0/150: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.333 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, potion_of_the_old_war
0:19.339 shred Fluffy_Pillow 84.6/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.344 shred Fluffy_Pillow 99.2/100: 99% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:21.350 shred Fluffy_Pillow 73.8/100: 74% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.355 shred Fluffy_Pillow 48.3/100: 48% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.360 Waiting 1.244 sec 22.9/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.604 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:25.608 healing_touch Fluffy_Pillow 15.5/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:26.362 Waiting 1.000 sec 26.4/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:27.362 savage_roar Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:29.895 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:30.899 Waiting 0.770 sec 19.0/100: 19% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:31.669 lunar_inspiration Fluffy_Pillow 31.5/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:32.675 shred Fluffy_Pillow 17.8/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:33.680 tigers_fury Fluffy_Pillow 34.2/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, blood_frenzy
0:33.680 shred Fluffy_Pillow 94.2/100: 94% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:34.685 healing_touch Fluffy_Pillow 85.5/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:35.440 rip Fluffy_Pillow 97.7/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
0:36.444 shadowmeld Fluffy_Pillow 99.1/100: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:36.444 rake Fluffy_Pillow 99.1/100: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:36.444 auto_attack Fluffy_Pillow 64.1/100: 64% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:37.449 shred Fluffy_Pillow 95.4/100: 95% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:38.453 shred Fluffy_Pillow 71.7/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:39.456 shred Fluffy_Pillow 48.0/100: 48% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:40.461 shred Fluffy_Pillow 23.3/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury
0:41.467 healing_touch Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
0:42.368 Waiting 3.900 sec 45.9/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:46.268 savage_roar Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:47.274 lunar_inspiration Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:48.278 shred Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:49.281 shred Fluffy_Pillow 13.0/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
0:50.286 healing_touch Fluffy_Pillow 24.2/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:51.185 rip Fluffy_Pillow 34.3/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:53.982 rake Fluffy_Pillow 35.5/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
0:54.988 Waiting 1.193 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:56.181 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
0:57.184 lunar_inspiration Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
0:58.189 healing_touch Fluffy_Pillow 47.4/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:59.090 Waiting 1.600 sec 57.4/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:00.690 ferocious_bite Fluffy_Pillow 75.3/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:01.696 rake Fluffy_Pillow 36.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:02.702 Waiting 1.099 sec 12.7/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:03.801 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:03.801 use_item_ravaged_seed_pod Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:03.801 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:04.806 shred Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:05.811 shred Fluffy_Pillow 57.4/100: 57% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:06.817 healing_touch Fluffy_Pillow 43.6/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:07.719 Waiting 3.200 sec 53.7/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
1:10.919 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
1:11.923 rake Fluffy_Pillow 70.6/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, leeching_pestilence
1:12.927 lunar_inspiration Fluffy_Pillow 46.8/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, leeching_pestilence
1:13.930 shred Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:14.934 Waiting 1.000 sec 29.2/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:15.934 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:16.941 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
1:19.629 savage_roar Fluffy_Pillow 41.6/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
1:21.654 ashamanes_frenzy Fluffy_Pillow 24.9/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
1:22.787 rake Fluffy_Pillow 39.0/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
1:23.791 healing_touch Fluffy_Pillow 51.6/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:24.595 Waiting 2.100 sec 61.6/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:26.695 rip Fluffy_Pillow 87.9/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:27.700 rake Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
1:28.705 lunar_inspiration Fluffy_Pillow 83.0/100: 83% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:29.709 shred Fluffy_Pillow 65.5/100: 66% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:30.715 Waiting 0.100 sec 38.1/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:30.815 shred Fluffy_Pillow 39.3/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
1:31.821 healing_touch Fluffy_Pillow 51.9/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:32.626 ferocious_bite Fluffy_Pillow 62.0/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:33.630 tigers_fury Fluffy_Pillow 23.6/100: 24% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:33.801 rake Fluffy_Pillow 85.6/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:34.805 shred Fluffy_Pillow 76.8/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.807 shred Fluffy_Pillow 62.9/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:36.811 healing_touch Fluffy_Pillow 49.1/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:37.710 Waiting 2.700 sec 59.2/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:40.410 rip Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:41.415 rake Fluffy_Pillow 70.5/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:42.419 lunar_inspiration Fluffy_Pillow 46.7/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:43.424 Waiting 1.100 sec 27.9/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:44.524 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
1:45.529 Waiting 2.620 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:48.149 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:49.154 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
1:51.845 savage_roar Fluffy_Pillow 42.9/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), blood_frenzy
1:54.380 rake Fluffy_Pillow 34.6/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
1:55.384 lunar_inspiration Fluffy_Pillow 47.1/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
1:56.389 shred Fluffy_Pillow 59.7/100: 60% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
1:57.396 Waiting 0.100 sec 32.3/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:57.496 shred Fluffy_Pillow 33.5/100: 34% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
1:58.499 shred Fluffy_Pillow 46.0/100: 46% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
1:59.504 healing_touch Fluffy_Pillow 58.6/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:00.310 rip Fluffy_Pillow 68.7/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
2:01.315 rake Fluffy_Pillow 50.9/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:02.317 Waiting 1.200 sec 27.1/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:03.517 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:04.520 tigers_fury Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:04.520 use_item_ravaged_seed_pod Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:04.520 shred Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:05.525 healing_touch Fluffy_Pillow 57.8/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:06.425 Waiting 0.600 sec 67.9/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:07.025 rip Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:08.028 rake Fluffy_Pillow 85.8/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:09.033 lunar_inspiration Fluffy_Pillow 62.0/100: 62% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:10.038 shred Fluffy_Pillow 43.2/100: 43% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:11.042 Waiting 1.250 sec 14.4/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:12.292 shred Fluffy_Pillow 28.3/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:13.296 healing_touch Fluffy_Pillow 39.5/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
2:14.196 savage_roar Fluffy_Pillow 49.6/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, leeching_pestilence, jacins_ruse
2:15.201 rake Fluffy_Pillow 60.8/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
2:16.207 Waiting 0.300 sec 37.0/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:16.507 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:17.512 Waiting 2.603 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:20.115 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:21.120 Waiting 1.181 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:22.301 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
2:23.306 healing_touch Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
2:24.208 rip Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:25.214 rake Fluffy_Pillow 57.5/100: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:26.218 Waiting 0.600 sec 33.7/100: 34% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:26.818 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:27.824 Waiting 2.600 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:30.424 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:31.429 Waiting 2.581 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:34.010 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:35.014 tigers_fury Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:35.014 healing_touch Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:35.914 rake Fluffy_Pillow 81.9/100: 82% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:36.918 Waiting 0.100 sec 73.1/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, ashamanes_energy, savage_roar, tigers_fury
2:37.018 rip Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, ashamanes_energy, savage_roar, tigers_fury
2:38.022 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
2:39.027 shred Fluffy_Pillow 81.2/100: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
2:40.031 shred Fluffy_Pillow 52.4/100: 52% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
2:41.036 healing_touch Fluffy_Pillow 23.6/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
2:42.702 savage_roar Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
2:43.706 ashamanes_frenzy Fluffy_Pillow 13.4/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:45.732 rake Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:46.736 Waiting 1.091 sec 13.9/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:47.827 shred Fluffy_Pillow 27.5/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
2:48.831 healing_touch Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:49.638 Waiting 3.000 sec 50.1/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
2:52.638 rip Fluffy_Pillow 87.6/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
2:53.643 rake Fluffy_Pillow 70.2/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:54.648 lunar_inspiration Fluffy_Pillow 47.7/100: 48% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:55.653 Waiting 0.900 sec 30.1/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:56.553 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:57.559 Waiting 2.624 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:00.183 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:01.187 Waiting 1.981 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:03.168 healing_touch Fluffy_Pillow 33.9/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:04.069 rake Fluffy_Pillow 44.0/100: 44% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
3:05.073 tigers_fury Fluffy_Pillow 20.2/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
3:05.073 berserk Fluffy_Pillow 80.2/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
3:05.073 use_item_ravaged_seed_pod Fluffy_Pillow 80.2/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury
3:05.073 rip Fluffy_Pillow 80.2/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence
3:06.078 lunar_inspiration Fluffy_Pillow 91.4/150: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:07.083 shred Fluffy_Pillow 102.6/150: 68% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, tigers_fury, leeching_pestilence
3:08.087 shred Fluffy_Pillow 108.8/150: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, tigers_fury, leeching_pestilence
3:09.093 shred Fluffy_Pillow 100.0/150: 67% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, tigers_fury, leeching_pestilence
3:10.098 healing_touch Fluffy_Pillow 91.2/150: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, tigers_fury, leeching_pestilence
3:10.997 savage_roar Fluffy_Pillow 101.3/150: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, tigers_fury, leeching_pestilence
3:12.002 shadowmeld Fluffy_Pillow 92.5/150: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:12.002 rake Fluffy_Pillow 92.5/150: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, clearcasting, bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:12.002 auto_attack Fluffy_Pillow 92.5/150: 62% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:13.005 shred Fluffy_Pillow 103.7/150: 69% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:14.008 shred Fluffy_Pillow 94.8/150: 63% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence
3:15.011 shred Fluffy_Pillow 86.0/150: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence
3:16.014 healing_touch Fluffy_Pillow 77.2/150: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:16.915 ferocious_bite Fluffy_Pillow 87.3/150: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:17.918 shred Fluffy_Pillow 73.5/150: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar
3:18.923 lunar_inspiration Fluffy_Pillow 84.7/150: 56% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar
3:19.929 shred Fluffy_Pillow 80.9/150: 54% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:20.932 healing_touch Fluffy_Pillow 72.1/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:21.833 Waiting 0.700 sec 82.1/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:22.533 rip Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:23.537 shred Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:24.542 shred Fluffy_Pillow 42.4/100: 42% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:27.595 rake Fluffy_Pillow 38.1/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:28.602 Waiting 2.045 sec 15.7/100: 16% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:30.647 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:31.652 healing_touch Fluffy_Pillow 13.8/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:32.459 Waiting 1.100 sec 23.9/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
3:33.559 savage_roar Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
3:34.563 rake Fluffy_Pillow 50.2/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
3:35.568 tigers_fury Fluffy_Pillow 27.7/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
3:35.568 lunar_inspiration Fluffy_Pillow 87.7/100: 88% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:36.575 shred Fluffy_Pillow 85.3/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:37.579 shred Fluffy_Pillow 72.8/100: 73% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:38.584 healing_touch Fluffy_Pillow 60.4/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:39.388 Waiting 1.400 sec 70.5/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
3:40.788 rip Fluffy_Pillow 87.9/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
3:41.793 rake Fluffy_Pillow 70.5/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:42.798 shred Fluffy_Pillow 48.1/100: 48% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:43.803 Waiting 1.050 sec 20.6/100: 21% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:44.853 shred Fluffy_Pillow 33.0/100: 33% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
3:45.858 shred Fluffy_Pillow 44.3/100: 44% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:46.863 Waiting 0.854 sec 15.5/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:47.717 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
3:48.721 healing_touch Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:49.620 Waiting 3.800 sec 46.2/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:53.420 rip Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:54.425 rake Fluffy_Pillow 69.8/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:55.430 shred Fluffy_Pillow 46.0/100: 46% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:56.435 Waiting 1.794 sec 17.3/100: 17% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:58.229 shred Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
3:59.234 healing_touch Fluffy_Pillow 48.5/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:00.135 savage_roar Fluffy_Pillow 58.5/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
4:01.139 ashamanes_frenzy Fluffy_Pillow 29.7/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:02.143 rake Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
4:03.148 healing_touch Fluffy_Pillow 17.1/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:04.049 Waiting 2.100 sec 27.2/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:06.149 ferocious_bite Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:07.153 tigers_fury Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:07.153 use_item_ravaged_seed_pod Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:07.153 lunar_inspiration Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:08.158 rake Fluffy_Pillow 68.0/100: 68% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:09.162 shred Fluffy_Pillow 94.2/100: 94% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:10.166 shred Fluffy_Pillow 80.4/100: 80% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:11.170 healing_touch Fluffy_Pillow 51.6/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:12.072 Waiting 2.200 sec 61.7/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
4:14.272 rip Fluffy_Pillow 87.3/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
4:15.277 rake Fluffy_Pillow 69.9/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, leeching_pestilence, blood_frenzy
4:16.283 shred Fluffy_Pillow 47.5/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, leeching_pestilence, blood_frenzy
4:17.286 Waiting 0.900 sec 20.0/100: 20% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:18.186 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:19.190 Waiting 2.197 sec 13.8/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:21.387 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:22.392 healing_touch Fluffy_Pillow 13.8/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:23.196 Waiting 1.000 sec 23.8/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
4:24.710 savage_roar Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
4:27.757 rake Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
4:28.761 Waiting 2.231 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:30.992 lunar_inspiration Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:31.997 rake Fluffy_Pillow 17.4/100: 17% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:33.002 healing_touch Fluffy_Pillow 28.6/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:33.901 rip Fluffy_Pillow 38.6/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:34.906 Waiting 1.864 sec 19.8/100: 20% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:36.770 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:37.774 tigers_fury Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:37.774 shred Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:38.778 shred Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:39.783 healing_touch Fluffy_Pillow 44.2/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:40.684 Waiting 1.800 sec 54.3/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:42.484 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:43.488 rake Fluffy_Pillow 70.6/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:44.493 shred Fluffy_Pillow 46.8/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
4:45.497 Waiting 1.130 sec 18.0/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
4:46.627 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:47.630 Waiting 1.186 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:48.816 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness
4:49.820 Waiting 0.400 sec 36.2/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
4:50.220 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
4:51.223 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:52.123 savage_roar Fluffy_Pillow 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
4:53.384 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:54.388 shred Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:55.390 Waiting 1.449 sec 23.3/100: 23% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:56.839 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:57.843 healing_touch Fluffy_Pillow 13.0/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
4:58.646 Waiting 4.761 sec 23.0/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:03.407 rip Fluffy_Pillow 82.5/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:04.412 rake Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:05.418 lunar_inspiration Fluffy_Pillow 42.6/100: 43% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:06.421 Waiting 0.200 sec 25.1/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:06.621 shred Fluffy_Pillow 27.6/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:07.626 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:08.629 healing_touch Fluffy_Pillow 52.7/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:09.434 savage_roar Fluffy_Pillow 62.8/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:10.438 tigers_fury Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
5:10.438 use_item_ravaged_seed_pod Fluffy_Pillow 95.3/100: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:10.438 rake Fluffy_Pillow 95.3/100: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
5:11.443 shred Fluffy_Pillow 87.9/100: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
5:12.448 shred Fluffy_Pillow 75.4/100: 75% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
5:13.452 healing_touch Fluffy_Pillow 63.0/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
5:14.256 Waiting 1.200 sec 73.0/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
5:15.456 rip Fluffy_Pillow 88.0/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
5:16.462 ashamanes_frenzy Fluffy_Pillow 70.6/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
5:17.465 lunar_inspiration Fluffy_Pillow 83.1/100: 83% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
5:18.469 shred Fluffy_Pillow 65.7/100: 66% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, leeching_pestilence, blood_frenzy
5:19.472 healing_touch Fluffy_Pillow 38.2/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, leeching_pestilence, blood_frenzy
5:20.276 Waiting 3.200 sec 48.3/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, leeching_pestilence, blood_frenzy
5:23.476 ferocious_bite Fluffy_Pillow 88.2/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:24.479 rake Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:25.484 shred Fluffy_Pillow 63.3/100: 63% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:26.488 Waiting 0.400 sec 35.9/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:26.888 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:27.893 Waiting 1.426 sec 13.4/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:29.319 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:30.324 healing_touch Fluffy_Pillow 13.8/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:31.128 Waiting 2.000 sec 23.8/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:33.128 rip Fluffy_Pillow 48.8/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
5:34.645 rake Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:35.648 Waiting 1.374 sec 15.3/100: 15% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:37.022 shred Fluffy_Pillow 32.5/100: 32% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:38.027 shred Fluffy_Pillow 45.1/100: 45% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:39.030 Waiting 1.193 sec 17.6/100: 18% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
5:40.223 tigers_fury Fluffy_Pillow 32.5/100: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, blood_frenzy, jacins_ruse
5:40.438 shred Fluffy_Pillow 95.2/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, blood_frenzy, jacins_ruse
5:41.442 healing_touch Fluffy_Pillow 82.7/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, blood_frenzy, jacins_ruse
5:42.246 savage_roar Fluffy_Pillow 92.8/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, blood_frenzy, jacins_ruse
5:43.250 shadowmeld Fluffy_Pillow 80.3/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:43.250 rake Fluffy_Pillow 80.3/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:43.250 auto_attack Fluffy_Pillow 45.3/100: 45% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:44.255 lunar_inspiration Fluffy_Pillow 72.9/100: 73% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:45.260 shred Fluffy_Pillow 54.5/100: 54% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:46.264 healing_touch Fluffy_Pillow 25.7/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:47.164 Waiting 1.500 sec 35.7/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
5:48.664 ferocious_bite Fluffy_Pillow 52.5/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:49.668 Waiting 2.415 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:52.083 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:53.088 Waiting 1.681 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:55.025 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:56.030 Waiting 0.994 sec 12.6/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:57.024 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:58.027 healing_touch Fluffy_Pillow 37.5/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:58.833 Waiting 3.200 sec 47.6/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
6:02.033 savage_roar Fluffy_Pillow 87.6/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
6:03.037 rake Fluffy_Pillow 60.1/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
6:04.042 lunar_inspiration Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
6:05.046 Waiting 0.482 sec 20.2/100: 20% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
6:05.528 ferocious_bite Fluffy_Pillow 26.2/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
6:06.530 Waiting 2.298 sec 12.5/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:08.828 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:09.834 Waiting 0.896 sec 13.8/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:10.730 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:10.730 berserk Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:10.730 use_item_ravaged_seed_pod Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:10.730 potion Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy
6:10.730 shred Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:11.734 shred Fluffy_Pillow 92.5/150: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:12.738 healing_touch Fluffy_Pillow 100.1/150: 67% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:13.543 rake Fluffy_Pillow 110.1/150: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:14.547 lunar_inspiration Fluffy_Pillow 120.2/150: 80% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, berserk, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:15.551 rip Fluffy_Pillow 117.7/150: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, berserk, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:16.555 shred Fluffy_Pillow 130.3/150: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:17.559 shred Fluffy_Pillow 122.8/150: 82% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:18.564 shred Fluffy_Pillow 115.4/150: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:19.569 shred Fluffy_Pillow 127.9/150: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:20.575 healing_touch Fluffy_Pillow 120.5/150: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, leeching_pestilence, blood_frenzy, potion_of_the_old_war
6:21.380 savage_roar Fluffy_Pillow 130.6/150: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, blood_frenzy, potion_of_the_old_war
6:22.385 rake Fluffy_Pillow 143.1/150: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:23.390 shred Fluffy_Pillow 138.2/150: 92% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:24.393 shred Fluffy_Pillow 129.6/150: 86% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:25.397 shred Fluffy_Pillow 120.8/150: 81% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:26.402 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:27.304 ferocious_bite Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:28.308 rake Fluffy_Pillow 61.2/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:29.311 lunar_inspiration Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:30.316 shred Fluffy_Pillow 18.6/100: 19% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, potion_of_the_old_war
6:31.320 Waiting 1.000 sec 29.8/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:32.320 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:33.324 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:34.225 Waiting 3.550 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:37.775 ferocious_bite Fluffy_Pillow 64.2/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
6:38.780 ashamanes_frenzy Fluffy_Pillow 26.8/100: 27% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
6:39.786 shred Fluffy_Pillow 39.4/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
6:40.791 shred Fluffy_Pillow 51.9/100: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
6:41.795 healing_touch Fluffy_Pillow 64.5/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
6:42.598 savage_roar Fluffy_Pillow 74.5/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
6:43.601 rake Fluffy_Pillow 47.0/100: 47% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
6:44.606 tigers_fury Fluffy_Pillow 24.6/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
6:44.606 lunar_inspiration Fluffy_Pillow 84.6/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:45.611 shred Fluffy_Pillow 82.1/100: 82% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
6:46.615 shred Fluffy_Pillow 68.8/100: 69% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:47.619 healing_touch Fluffy_Pillow 55.0/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
6:48.520 Waiting 1.900 sec 65.1/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
6:50.420 ferocious_bite Fluffy_Pillow 88.0/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy, jacins_ruse
6:51.423 rake Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
6:52.428 shred Fluffy_Pillow 28.1/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
6:53.433 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
6:54.439 Waiting 1.440 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
6:55.879 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
6:56.883 Waiting 2.197 sec 13.8/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
6:59.080 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
7:00.084 healing_touch Fluffy_Pillow 12.5/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:00.983 Waiting 2.324 sec 22.5/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:03.307 savage_roar Fluffy_Pillow 51.0/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
7:04.311 rake Fluffy_Pillow 63.6/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
7:05.315 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
7:06.320 Waiting 2.004 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:08.324 ferocious_bite Fluffy_Pillow 38.7/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:09.328 Waiting 1.496 sec 12.5/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:10.824 lunar_inspiration Fluffy_Pillow 31.2/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:11.829 Waiting 0.896 sec 13.8/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:12.725 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
7:13.729 Waiting 0.100 sec 37.5/100: 38% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
7:13.829 healing_touch Fluffy_Pillow 38.7/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:14.729 rake Fluffy_Pillow 48.7/100: 49% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:15.732 tigers_fury Fluffy_Pillow 24.9/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar, jacins_ruse
7:15.732 use_item_ravaged_seed_pod Fluffy_Pillow 84.9/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
7:15.732 shred Fluffy_Pillow 84.9/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
7:16.737 Waiting 1.000 sec 71.1/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
7:17.737 ferocious_bite Fluffy_Pillow 97.3/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
7:18.741 shred Fluffy_Pillow 98.5/100: 98% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
7:19.746 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
7:20.750 shred Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
7:21.755 shred Fluffy_Pillow 42.4/100: 42% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
7:22.760 healing_touch Fluffy_Pillow 13.6/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
7:23.661 Waiting 0.418 sec 23.7/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
7:24.079 savage_roar Fluffy_Pillow 28.3/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, leeching_pestilence, jacins_ruse
7:25.082 rake Fluffy_Pillow 39.5/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
7:26.088 Waiting 2.029 sec 15.7/100: 16% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
7:28.117 lunar_inspiration Fluffy_Pillow 38.4/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
7:29.122 Waiting 0.984 sec 19.6/100: 20% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 23138 21431 11378 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 27766 25717 0
Crit 33.77% 33.77% 6220
Haste 11.56% 11.56% 3756
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 23138 21431 0
Mastery 51.70% 49.54% 5871
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 847.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Bloodthirsty Instinct
ilevel: 865, stats: { +1418 Agi }
Local Trinket2 Ravaged Seed Pod
ilevel: 865, stats: { +986 Haste }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="instinct_865 / pod_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/use_item,slot=trinket2,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1805
trinket2=ravaged_seed_pod,id=139320,bonus_id=1805
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=846.88
# gear_agility=11378
# gear_stamina=17628
# gear_crit_rating=6220
# gear_haste_rating=2504
# gear_mastery_rating=5871
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

Simulation & Raid Information

Iterations: 2502
Threads: 3
Confidence: 95.00%
Fight Length (fixed time): 360 - 540 ( 450.0 )

Performance:
Total Events Processed: 233769439
Max Event Queue: 525
Sim Seconds: 1126025
CPU Seconds: 376.3056
Physical Seconds: 200.5022
Speed Up: 2992

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
appendages_865 / call_865 appendages_865 / call_865 ashamanes_frenzy 210722 1247637 2772 12.19 10069 20152 6.1 91.4 35.5% 0.0% 0.0% 0.0% 78.57sec 7292810 450.05sec
appendages_865 / call_865 appendages_865 / call_865 ashamanes_frenzy ticks -210722 5458666 12130 16.22 133228 266409 6.1 121.6 35.6% 0.0% 0.0% 0.0% 78.57sec 7292810 450.05sec
appendages_865 / call_865 appendages_865 / call_865 ashamanes_rip ticks -210705 16338882 36309 19.11 84120 168318 18.2 143.3 35.5% 0.0% 0.0% 0.0% 23.15sec 16338882 450.05sec
appendages_865 / call_865 appendages_865 / call_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
appendages_865 / call_865 appendages_865 / call_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 181.97sec 0 450.05sec
appendages_865 / call_865 appendages_865 / call_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
appendages_865 / call_865 appendages_865 / call_865 cat_melee 0 12483861 27739 67.42 18232 36459 505.7 505.7 35.4% 0.0% 0.0% 0.0% 0.89sec 18352458 450.05sec
appendages_865 / call_865 appendages_865 / call_865 cleansed_drakes_breath 222520 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 78.73sec 0 450.05sec
appendages_865 / call_865 appendages_865 / call_865 ferocious_bite 22568 2821083 6268 1.40 188189 419372 10.5 10.5 34.9% 0.0% 0.0% 0.0% 45.04sec 4147260 450.05sec
appendages_865 / call_865 appendages_865 / call_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
appendages_865 / call_865 appendages_865 / call_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
appendages_865 / call_865 appendages_865 / call_865 healing_touch 5185 0 0 0.00 0 0 50.1 0.0 0.0% 0.0% 0.0% 0.0% 9.10sec 0 450.05sec
appendages_865 / call_865 appendages_865 / call_865 horrific_slam 222168 3158255 7018 13.17 23608 47214 98.8 98.8 35.4% 0.0% 0.0% 0.0% 3.57sec 3158255 450.05sec
appendages_865 / call_865 appendages_865 / call_865 lunar_inspiration 155625 1411208 3136 4.21 33027 66018 31.6 31.6 35.4% 0.0% 0.0% 0.0% 14.35sec 9990424 450.05sec
appendages_865 / call_865 appendages_865 / call_865 lunar_inspiration ticks -155625 8579216 19065 33.29 25389 50740 31.6 249.7 35.4% 0.0% 0.0% 0.0% 14.35sec 9990424 450.05sec
appendages_865 / call_865 appendages_865 / call_865 mark_of_the_distant_army ticks -191380 984751 2188 9.53 13775 0 24.2 71.5 0.0% 0.0% 0.0% 0.0% 18.46sec 1447677 450.05sec
appendages_865 / call_865 appendages_865 / call_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
appendages_865 / call_865 appendages_865 / call_865 potion_of_the_old_war 188028 4988693 11085 3.14 156401 313553 23.6 23.6 35.3% 0.0% 0.0% 0.0% 17.36sec 7333851 450.05sec
appendages_865 / call_865 appendages_865 / call_865 rake 1822 5505347 12233 6.28 86222 172597 47.1 47.1 35.4% 0.0% 0.0% 0.0% 9.57sec 31731874 450.05sec
appendages_865 / call_865 appendages_865 / call_865 rake ticks -1822 26226527 58281 29.79 86706 173470 47.1 223.4 35.3% 0.0% 0.0% 0.0% 9.57sec 31731874 450.05sec
appendages_865 / call_865 appendages_865 / call_865 rip ticks -1079 38201025 84891 43.50 86486 172958 22.8 326.2 35.4% 0.0% 0.0% 0.0% 15.61sec 38201025 450.05sec
appendages_865 / call_865 appendages_865 / call_865 savage_roar 52610 0 0 0.00 0 0 18.5 0.0 0.0% 0.0% 0.0% 0.0% 24.73sec 0 450.05sec
appendages_865 / call_865 appendages_865 / call_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.20sec 0 450.05sec
appendages_865 / call_865 appendages_865 / call_865 shred 5221 12922638 28714 14.35 88606 177233 107.7 107.7 35.5% 0.0% 0.0% 0.0% 4.17sec 18997502 450.05sec
appendages_865 / call_865 appendages_865 / call_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.33sec 0 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 ashamanes_frenzy 210722 1207041 2682 12.19 9861 19726 6.1 91.4 33.9% 0.0% 0.0% 0.0% 78.65sec 7049293 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 ashamanes_frenzy ticks -210722 5274828 11722 16.22 130415 261063 6.1 121.6 33.8% 0.0% 0.0% 0.0% 78.65sec 7049293 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 ashamanes_rip ticks -210705 16151343 35892 19.52 82505 164924 18.7 146.4 33.7% 0.0% 0.0% 0.0% 22.56sec 16151343 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 181.96sec 0 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 cat_melee 0 12554509 27896 68.57 18233 36469 514.3 514.3 33.9% 0.0% 0.0% 0.0% 0.87sec 18456317 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 ferocious_bite 22568 2815898 6257 1.41 188879 420607 10.6 10.6 33.6% 0.0% 0.0% 0.0% 44.57sec 4139637 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 healing_touch 5185 0 0 0.00 0 0 50.2 0.0 0.0% 0.0% 0.0% 0.0% 9.08sec 0 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 horrific_slam 222168 3217593 7149 13.57 23613 47237 101.8 101.8 33.8% 0.0% 0.0% 0.0% 3.48sec 3217593 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 infested_ground 221803 2374112 5275 10.36 22840 45676 7.9 77.7 33.8% 0.0% 0.0% 0.0% 60.66sec 2374112 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 lunar_inspiration 155625 1397032 3104 4.22 33020 66031 31.6 31.6 33.8% 0.0% 0.0% 0.0% 14.34sec 10031496 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 lunar_inspiration ticks -155625 8634464 19188 33.82 25450 50910 31.6 253.7 33.7% 0.0% 0.0% 0.0% 14.34sec 10031496 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 mark_of_the_distant_army ticks -191380 998373 2219 9.67 13766 0 24.5 72.5 0.0% 0.0% 0.0% 0.0% 18.27sec 1467703 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 potion_of_the_old_war 188028 4991900 11092 3.17 156639 313724 23.8 23.8 33.9% 0.0% 0.0% 0.0% 17.03sec 7338566 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 rake 1822 5341656 11869 6.29 84533 168760 47.2 47.2 34.0% 0.0% 0.0% 0.0% 9.56sec 30786712 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 rake ticks -1822 25445055 56545 29.82 85030 170146 47.2 223.7 33.8% 0.0% 0.0% 0.0% 9.56sec 30786712 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 rip ticks -1079 37012973 82251 43.53 84795 169590 22.9 326.5 33.7% 0.0% 0.0% 0.0% 15.52sec 37012973 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 savage_roar 52610 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 24.72sec 0 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.75sec 0 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 shred 5221 13020245 28931 14.67 88439 176900 110.0 110.0 33.8% 0.0% 0.0% 0.0% 4.08sec 19140993 450.05sec
appendages_865 / pod_865 appendages_865 / pod_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.33sec 0 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 ashamanes_frenzy 210722 1286100 2858 12.18 10329 20645 6.1 91.4 36.3% 0.0% 0.0% 0.0% 78.64sec 7512740 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 ashamanes_frenzy ticks -210722 5622050 12493 16.21 136607 273175 6.1 121.6 36.2% 0.0% 0.0% 0.0% 78.64sec 7512740 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 ashamanes_rip ticks -210705 17152243 38116 19.42 86506 173124 18.4 145.6 36.1% 0.0% 0.0% 0.0% 22.90sec 17152243 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 181.89sec 0 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 cat_melee 0 12911649 28689 68.04 18588 37184 510.4 510.4 36.1% 0.0% 0.0% 0.0% 0.88sec 18981347 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 ferocious_bite 22568 2998971 6664 1.43 194909 429363 10.7 10.7 36.5% 0.0% 0.0% 0.0% 43.97sec 4408772 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 healing_touch 5185 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 9.01sec 0 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 horrific_slam 222168 3296653 7325 13.42 24065 48125 100.7 100.7 36.1% 0.0% 0.0% 0.0% 3.51sec 3296653 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 lunar_inspiration 155625 1443494 3207 4.21 33634 67348 31.6 31.6 35.8% 0.0% 0.0% 0.0% 14.35sec 10314287 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 lunar_inspiration ticks -155625 8870793 19713 33.58 25886 51743 31.6 251.9 36.1% 0.0% 0.0% 0.0% 14.35sec 10314287 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 mark_of_the_distant_army ticks -191380 1009212 2243 9.58 14043 0 24.3 71.9 0.0% 0.0% 0.0% 0.0% 18.26sec 1483637 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 potion_of_the_old_war 188028 5120638 11378 3.14 159751 319433 23.6 23.6 36.1% 0.0% 0.0% 0.0% 17.30sec 7527822 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 rake 1822 5704093 12674 6.30 88725 177288 47.3 47.3 36.0% 0.0% 0.0% 0.0% 9.54sec 32851877 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 rake ticks -1822 27147785 60328 29.81 89304 178610 47.3 223.6 36.0% 0.0% 0.0% 0.0% 9.54sec 32851877 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 rip ticks -1079 39539629 87866 43.55 88953 177873 22.9 326.7 36.1% 0.0% 0.0% 0.0% 15.46sec 39539629 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 savage_roar 52610 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 24.65sec 0 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.29sec 0 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 shred 5221 13340412 29642 14.46 90387 180702 108.5 108.5 36.1% 0.0% 0.0% 0.0% 4.14sec 19611670 450.05sec
arcanocrystal_860 / appendages_865 arcanocrystal_860 / appendages_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.32sec 0 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 ashamanes_frenzy 210722 1286383 2858 12.21 10192 20397 6.1 91.6 37.8% 0.0% 0.0% 0.0% 78.36sec 7513764 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 ashamanes_frenzy ticks -210722 5622659 12495 16.25 134840 269761 6.1 121.8 37.8% 0.0% 0.0% 0.0% 78.36sec 7513764 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 ashamanes_rip ticks -210705 17517772 38928 19.85 85470 170815 18.8 148.9 37.7% 0.0% 0.0% 0.0% 22.77sec 17517772 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.04sec 0 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 cat_melee 0 13411911 29801 69.72 18612 37241 522.9 522.9 37.8% 0.0% 0.0% 0.0% 0.86sec 19716780 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 cleansed_drakes_breath 222520 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 78.86sec 0 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 ferocious_bite 22568 3304286 7342 1.51 200113 441658 11.3 11.3 37.7% 0.0% 0.0% 0.0% 41.32sec 4857614 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 healing_touch 5185 0 0 0.00 0 0 51.7 0.0 0.0% 0.0% 0.0% 0.0% 8.81sec 0 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 lunar_inspiration 155625 1467546 3261 4.22 33697 67353 31.6 31.6 37.8% 0.0% 0.0% 0.0% 14.33sec 10689822 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 lunar_inspiration ticks -155625 9222276 20494 34.36 25993 52002 31.6 257.7 37.7% 0.0% 0.0% 0.0% 14.33sec 10689822 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 mark_of_the_distant_army ticks -191380 1037126 2305 9.84 14060 0 25.0 73.8 0.0% 0.0% 0.0% 0.0% 17.96sec 1524673 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 potion_of_the_old_war 188028 5364099 11919 3.24 159709 319888 24.3 24.3 37.9% 0.0% 0.0% 0.0% 16.76sec 7885733 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 rake 1822 5737552 12749 6.34 87583 175014 47.5 47.5 37.9% 0.0% 0.0% 0.0% 9.49sec 32978697 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 rake ticks -1822 27241144 60536 29.81 88465 176703 47.5 223.6 37.8% 0.0% 0.0% 0.0% 9.49sec 32978697 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 rip ticks -1079 39642738 88095 43.67 87852 175728 23.1 327.5 37.8% 0.0% 0.0% 0.0% 15.31sec 39642738 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 savage_roar 52610 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 24.41sec 0 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.03sec 0 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 shred 5221 13774727 30607 14.71 90574 181237 110.4 110.4 37.8% 0.0% 0.0% 0.0% 4.07sec 20250153 450.05sec
arcanocrystal_860 / call_865 arcanocrystal_860 / call_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.34sec 0 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 ashamanes_frenzy 210722 1243019 2762 12.19 9987 19974 6.1 91.4 36.1% 0.0% 0.0% 0.0% 78.37sec 7277044 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 ashamanes_frenzy ticks -210722 5449688 12110 16.22 132099 264251 6.1 121.7 36.4% 0.0% 0.0% 0.0% 78.37sec 7277044 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 ashamanes_rip ticks -210705 17155108 38122 20.03 83857 167821 18.9 150.3 36.1% 0.0% 0.0% 0.0% 22.53sec 17155108 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.02sec 0 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 cat_melee 0 13457040 29901 70.85 18614 37231 531.5 531.5 36.0% 0.0% 0.0% 0.0% 0.85sec 19783123 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 ferocious_bite 22568 3291326 7313 1.52 200373 444341 11.4 11.4 36.3% 0.0% 0.0% 0.0% 41.34sec 4838560 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 healing_touch 5185 0 0 0.00 0 0 51.8 0.0 0.0% 0.0% 0.0% 0.0% 8.79sec 0 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 infested_ground 221803 2462855 5472 10.36 23295 46641 7.9 77.7 36.0% 0.0% 0.0% 0.0% 60.68sec 2462855 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 lunar_inspiration 155625 1452504 3227 4.22 33682 67358 31.7 31.7 36.2% 0.0% 0.0% 0.0% 14.31sec 10725429 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 lunar_inspiration ticks -155625 9272925 20607 35.17 25844 51674 31.7 263.8 36.0% 0.0% 0.0% 0.0% 14.31sec 10725429 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 mark_of_the_distant_army ticks -191380 1055955 2347 10.02 14054 0 25.4 75.1 0.0% 0.0% 0.0% 0.0% 17.60sec 1552354 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 potion_of_the_old_war 188028 5352906 11894 3.28 159381 319368 24.6 24.6 36.2% 0.0% 0.0% 0.0% 16.44sec 7869279 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 rake 1822 5545758 12323 6.33 85941 171859 47.5 47.5 35.9% 0.0% 0.0% 0.0% 9.49sec 31937691 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 rake ticks -1822 26391933 58649 29.84 86680 173519 47.5 223.8 36.0% 0.0% 0.0% 0.0% 9.49sec 31937691 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 rip ticks -1079 38418713 85375 43.68 86174 172424 23.1 327.6 36.0% 0.0% 0.0% 0.0% 15.26sec 38418713 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 savage_roar 52610 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 24.42sec 0 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.08sec 0 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 shred 5221 13877903 30836 15.05 90435 180810 112.9 112.9 36.0% 0.0% 0.0% 0.0% 3.98sec 20401832 450.05sec
arcanocrystal_860 / pod_865 arcanocrystal_860 / pod_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.34sec 0 450.05sec
baseline baseline ashamanes_frenzy 210722 1162665 2583 12.17 9514 19023 6.1 91.3 33.9% 0.0% 0.0% 0.0% 78.68sec 6784644 450.05sec
baseline baseline ashamanes_frenzy ticks -210722 5075416 11279 16.19 125847 251654 6.1 121.4 33.6% 0.0% 0.0% 0.0% 78.68sec 6784644 450.05sec
baseline baseline ashamanes_rip ticks -210705 14861895 33026 18.67 79373 158625 17.9 140.0 33.8% 0.0% 0.0% 0.0% 23.57sec 14861895 450.05sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
baseline baseline berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.01sec 0 450.05sec
baseline baseline cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
baseline baseline cat_melee 0 12013654 26694 65.78 18195 36397 493.4 493.4 33.8% 0.0% 0.0% 0.0% 0.91sec 17661209 450.05sec
baseline baseline ferocious_bite 22568 2544342 5653 1.32 182671 403584 9.9 9.9 33.6% 0.0% 0.0% 0.0% 48.08sec 3740424 450.05sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
baseline baseline healing_touch 5185 0 0 0.00 0 0 48.9 0.0 0.0% 0.0% 0.0% 0.0% 9.32sec 0 450.05sec
baseline baseline lunar_inspiration 155625 1392485 3094 4.21 32963 65940 31.5 31.5 33.9% 0.0% 0.0% 0.0% 14.37sec 9636750 450.05sec
baseline baseline lunar_inspiration ticks -155625 8244265 18321 32.27 25443 50922 31.5 242.1 33.8% 0.0% 0.0% 0.0% 14.37sec 9636750 450.05sec
baseline baseline mark_of_the_distant_army ticks -191380 951215 2114 9.22 13753 0 23.4 69.2 0.0% 0.0% 0.0% 0.0% 19.03sec 1398375 450.05sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
baseline baseline potion_of_the_old_war 188028 4810919 10690 3.06 156394 312706 23.0 23.0 33.9% 0.0% 0.0% 0.0% 17.83sec 7072506 450.05sec
baseline baseline rake 1822 5095924 11323 6.25 81222 162977 46.9 46.9 33.7% 0.0% 0.0% 0.0% 9.62sec 29466894 450.05sec
baseline baseline rake ticks -1822 24370970 54158 29.81 81569 163063 46.9 223.6 33.7% 0.0% 0.0% 0.0% 9.62sec 29466894 450.05sec
baseline baseline rip ticks -1079 35461673 78804 43.34 81544 163044 22.6 325.1 33.8% 0.0% 0.0% 0.0% 15.85sec 35461673 450.05sec
baseline baseline savage_roar 52610 0 0 0.00 0 0 18.4 0.0 0.0% 0.0% 0.0% 0.0% 24.96sec 0 450.05sec
baseline baseline shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 134.28sec 0 450.05sec
baseline baseline shred 5221 12489120 27751 14.09 88420 176723 105.7 105.7 33.7% 0.0% 0.0% 0.0% 4.25sec 18360189 450.05sec
baseline baseline tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.34sec 0 450.05sec
call_865 / pod_865 call_865 / pod_865 ashamanes_frenzy 210722 1204804 2677 12.19 9715 19439 6.1 91.5 35.6% 0.0% 0.0% 0.0% 78.38sec 7039117 450.05sec
call_865 / pod_865 call_865 / pod_865 ashamanes_frenzy ticks -210722 5267941 11707 16.22 128547 257023 6.1 121.7 35.6% 0.0% 0.0% 0.0% 78.38sec 7039117 450.05sec
call_865 / pod_865 call_865 / pod_865 ashamanes_rip ticks -210705 16485942 36635 19.93 81536 162915 19.0 149.5 35.4% 0.0% 0.0% 0.0% 22.39sec 16485942 450.05sec
call_865 / pod_865 call_865 / pod_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
call_865 / pod_865 call_865 / pod_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.08sec 0 450.05sec
call_865 / pod_865 call_865 / pod_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
call_865 / pod_865 call_865 / pod_865 cat_melee 0 13022335 28935 70.21 18260 36515 526.6 526.6 35.4% 0.0% 0.0% 0.0% 0.85sec 19144066 450.05sec
call_865 / pod_865 call_865 / pod_865 cleansed_drakes_breath 222520 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 77.54sec 0 450.05sec
call_865 / pod_865 call_865 / pod_865 ferocious_bite 22568 3115462 6922 1.49 195135 432003 11.2 11.2 35.4% 0.0% 0.0% 0.0% 42.02sec 4580024 450.05sec
call_865 / pod_865 call_865 / pod_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
call_865 / pod_865 call_865 / pod_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
call_865 / pod_865 call_865 / pod_865 healing_touch 5185 0 0 0.00 0 0 51.4 0.0 0.0% 0.0% 0.0% 0.0% 8.87sec 0 450.05sec
call_865 / pod_865 call_865 / pod_865 infested_ground 221803 2399889 5332 10.35 22863 45719 7.9 77.6 35.2% 0.0% 0.0% 0.0% 60.70sec 2399889 450.05sec
call_865 / pod_865 call_865 / pod_865 lunar_inspiration 155625 1414188 3142 4.22 33049 66096 31.7 31.7 35.2% 0.0% 0.0% 0.0% 14.32sec 10382106 450.05sec
call_865 / pod_865 call_865 / pod_865 lunar_inspiration ticks -155625 8967918 19929 34.56 25542 51083 31.7 259.2 35.5% 0.0% 0.0% 0.0% 14.32sec 10382106 450.05sec
call_865 / pod_865 call_865 / pod_865 mark_of_the_distant_army ticks -191380 1022465 2272 9.89 13790 0 25.1 74.1 0.0% 0.0% 0.0% 0.0% 17.85sec 1503121 450.05sec
call_865 / pod_865 call_865 / pod_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
call_865 / pod_865 call_865 / pod_865 potion_of_the_old_war 188028 5179287 11508 3.26 156767 313667 24.4 24.4 35.2% 0.0% 0.0% 0.0% 16.65sec 7614043 450.05sec
call_865 / pod_865 call_865 / pod_865 rake 1822 5369108 11930 6.34 83397 167197 47.5 47.5 35.3% 0.0% 0.0% 0.0% 9.49sec 30906603 450.05sec
call_865 / pod_865 call_865 / pod_865 rake ticks -1822 25537495 56750 29.85 84239 168525 47.5 223.9 35.4% 0.0% 0.0% 0.0% 9.49sec 30906603 450.05sec
call_865 / pod_865 call_865 / pod_865 rip ticks -1079 37132677 82517 43.65 83790 167494 23.0 327.4 35.4% 0.0% 0.0% 0.0% 15.33sec 37132677 450.05sec
call_865 / pod_865 call_865 / pod_865 savage_roar 52610 0 0 0.00 0 0 18.7 0.0 0.0% 0.0% 0.0% 0.0% 24.50sec 0 450.05sec
call_865 / pod_865 call_865 / pod_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.10sec 0 450.05sec
call_865 / pod_865 call_865 / pod_865 shred 5221 13448318 29882 14.95 88632 177225 112.1 112.1 35.3% 0.0% 0.0% 0.0% 4.01sec 19770301 450.05sec
call_865 / pod_865 call_865 / pod_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.35sec 0 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 ashamanes_frenzy 210722 1286978 2860 12.18 10540 21070 6.1 91.3 33.7% 0.0% 0.0% 0.0% 78.53sec 7521193 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 ashamanes_frenzy ticks -210722 5629214 12509 16.20 139390 278875 6.1 121.5 33.7% 0.0% 0.0% 0.0% 78.53sec 7521193 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 ashamanes_rip ticks -210705 17162971 38140 19.39 88219 176426 18.6 145.4 33.8% 0.0% 0.0% 0.0% 22.97sec 17162971 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 181.99sec 0 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 cat_melee 0 13238845 29416 69.07 19105 38208 518.1 518.1 33.8% 0.0% 0.0% 0.0% 0.87sec 19462356 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 ferocious_bite 22568 3102284 6893 1.43 204610 452273 10.7 10.7 34.2% 0.0% 0.0% 0.0% 43.82sec 4560651 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 healing_touch 5185 0 0 0.00 0 0 50.5 0.0 0.0% 0.0% 0.0% 0.0% 9.03sec 0 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 horrific_slam 222168 3191780 7092 13.46 23611 47216 101.0 101.0 33.9% 0.0% 0.0% 0.0% 3.49sec 3191780 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 lunar_inspiration 155625 1495270 3322 4.22 35281 70599 31.7 31.7 33.8% 0.0% 0.0% 0.0% 14.32sec 10791539 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 lunar_inspiration ticks -155625 9296270 20658 34.12 27176 54330 31.7 255.9 33.7% 0.0% 0.0% 0.0% 14.32sec 10791539 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 mark_of_the_distant_army ticks -191380 1000298 2223 9.68 13772 0 24.6 72.6 0.0% 0.0% 0.0% 0.0% 18.22sec 1470533 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 potion_of_the_old_war 188028 5047927 11216 3.21 156588 313255 24.1 24.1 34.0% 0.0% 0.0% 0.0% 16.97sec 7420930 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 rake 1822 5716736 12702 6.30 90368 180668 47.3 47.3 33.8% 0.0% 0.0% 0.0% 9.54sec 32954625 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 rake ticks -1822 27237888 60529 29.83 91008 182039 47.3 223.7 33.8% 0.0% 0.0% 0.0% 9.54sec 32954625 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 rip ticks -1079 39588432 87974 43.53 90655 181293 22.9 326.4 33.8% 0.0% 0.0% 0.0% 15.49sec 39588432 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 savage_roar 52610 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 24.70sec 0 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 132.84sec 0 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 shred 5221 13754820 30563 14.77 92744 185256 110.8 110.8 33.9% 0.0% 0.0% 0.0% 4.06sec 20220888 450.05sec
instinct_865 / appendages_865 instinct_865 / appendages_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.34sec 0 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 ashamanes_frenzy 210722 1331691 2959 12.20 10687 21379 6.1 91.5 36.1% 0.0% 0.0% 0.0% 78.38sec 7791468 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 ashamanes_frenzy ticks -210722 5833755 12964 16.24 141403 282732 6.1 121.8 36.3% 0.0% 0.0% 0.0% 78.38sec 7791468 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 ashamanes_rip ticks -210705 18424013 40942 20.18 89510 179047 19.0 151.3 36.0% 0.0% 0.0% 0.0% 22.28sec 18424013 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.07sec 0 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 cat_melee 0 14199460 31551 71.33 19503 39001 535.0 535.0 36.1% 0.0% 0.0% 0.0% 0.84sec 20874552 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 ferocious_bite 22568 3589557 7976 1.54 215922 478628 11.5 11.5 36.3% 0.0% 0.0% 0.0% 40.53sec 5276990 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 healing_touch 5185 0 0 0.00 0 0 52.1 0.0 0.0% 0.0% 0.0% 0.0% 8.74sec 0 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 lunar_inspiration 155625 1552219 3449 4.22 36040 72048 31.7 31.7 36.0% 0.0% 0.0% 0.0% 14.29sec 11541060 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 lunar_inspiration ticks -155625 9988841 22197 35.27 27752 55519 31.7 264.5 36.1% 0.0% 0.0% 0.0% 14.29sec 11541060 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 mark_of_the_distant_army ticks -191380 1055008 2344 10.01 14047 0 25.4 75.1 0.0% 0.0% 0.0% 0.0% 17.53sec 1550962 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 potion_of_the_old_war 188028 5426992 12059 3.32 159689 319493 24.9 24.9 36.3% 0.0% 0.0% 0.0% 16.21sec 7978192 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 rake 1822 5936901 13192 6.35 91879 183313 47.6 47.6 35.9% 0.0% 0.0% 0.0% 9.48sec 34169501 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 rake ticks -1822 28232600 62739 29.83 92732 185337 47.6 223.7 36.1% 0.0% 0.0% 0.0% 9.48sec 34169501 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 rip ticks -1079 41084736 91299 43.71 92103 184186 23.2 327.8 36.1% 0.0% 0.0% 0.0% 15.22sec 41084736 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 savage_roar 52610 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 24.40sec 0 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.33sec 0 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 shred 5221 14650640 32553 15.15 94729 189512 113.6 113.6 36.1% 0.0% 0.0% 0.0% 3.95sec 21537829 450.05sec
instinct_865 / arcanocrystal_860 instinct_865 / arcanocrystal_860 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.35sec 0 450.05sec
instinct_865 / call_865 instinct_865 / call_865 ashamanes_frenzy 210722 1288515 2863 12.21 10391 20787 6.1 91.6 35.4% 0.0% 0.0% 0.0% 78.34sec 7525867 450.05sec
instinct_865 / call_865 instinct_865 / call_865 ashamanes_frenzy ticks -210722 5631628 12515 16.25 137424 275121 6.1 121.9 35.3% 0.0% 0.0% 0.0% 78.34sec 7525867 450.05sec
instinct_865 / call_865 instinct_865 / call_865 ashamanes_rip ticks -210705 17640528 39201 19.95 87068 174109 19.0 149.6 35.4% 0.0% 0.0% 0.0% 22.07sec 17640528 450.05sec
instinct_865 / call_865 instinct_865 / call_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / call_865 instinct_865 / call_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.02sec 0 450.05sec
instinct_865 / call_865 instinct_865 / call_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / call_865 instinct_865 / call_865 cat_melee 0 13734143 30517 70.69 19130 38258 530.3 530.3 35.4% 0.0% 0.0% 0.0% 0.85sec 20190491 450.05sec
instinct_865 / call_865 instinct_865 / call_865 cleansed_drakes_breath 222520 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 77.35sec 0 450.05sec
instinct_865 / call_865 instinct_865 / call_865 ferocious_bite 22568 3372768 7494 1.50 209321 463312 11.3 11.3 35.5% 0.0% 0.0% 0.0% 41.44sec 4958289 450.05sec
instinct_865 / call_865 instinct_865 / call_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / call_865 instinct_865 / call_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / call_865 instinct_865 / call_865 healing_touch 5185 0 0 0.00 0 0 51.6 0.0 0.0% 0.0% 0.0% 0.0% 8.82sec 0 450.05sec
instinct_865 / call_865 instinct_865 / call_865 lunar_inspiration 155625 1511058 3358 4.22 35330 70587 31.7 31.7 35.2% 0.0% 0.0% 0.0% 14.32sec 11172012 450.05sec
instinct_865 / call_865 instinct_865 / call_865 lunar_inspiration ticks -155625 9660954 21469 34.95 27219 54438 31.7 262.1 35.4% 0.0% 0.0% 0.0% 14.32sec 11172012 450.05sec
instinct_865 / call_865 instinct_865 / call_865 mark_of_the_distant_army ticks -191380 1031356 2292 9.97 13792 0 25.3 74.8 0.0% 0.0% 0.0% 0.0% 17.68sec 1516191 450.05sec
instinct_865 / call_865 instinct_865 / call_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / call_865 instinct_865 / call_865 potion_of_the_old_war 188028 5227840 11616 3.28 156615 313358 24.6 24.6 35.6% 0.0% 0.0% 0.0% 16.47sec 7685420 450.05sec
instinct_865 / call_865 instinct_865 / call_865 rake 1822 5734327 12742 6.33 89164 178905 47.5 47.5 35.2% 0.0% 0.0% 0.0% 9.50sec 33049229 450.05sec
instinct_865 / call_865 instinct_865 / call_865 rake ticks -1822 27314902 60700 29.83 90021 180387 47.5 223.7 35.5% 0.0% 0.0% 0.0% 9.50sec 33049229 450.05sec
instinct_865 / call_865 instinct_865 / call_865 rip ticks -1079 39663905 88142 43.63 89501 179043 23.0 327.3 35.4% 0.0% 0.0% 0.0% 15.38sec 39663905 450.05sec
instinct_865 / call_865 instinct_865 / call_865 savage_roar 52610 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 24.46sec 0 450.05sec
instinct_865 / call_865 instinct_865 / call_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 132.77sec 0 450.05sec
instinct_865 / call_865 instinct_865 / call_865 shred 5221 14187263 31524 15.04 92893 185816 112.8 112.8 35.4% 0.0% 0.0% 0.0% 3.98sec 20856621 450.05sec
instinct_865 / call_865 instinct_865 / call_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.34sec 0 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 ashamanes_frenzy 210722 1248468 2774 12.22 10178 20356 6.1 91.7 33.8% 0.0% 0.0% 0.0% 78.41sec 7282930 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 ashamanes_frenzy ticks -210722 5447564 12106 16.26 134592 269390 6.1 122.0 33.6% 0.0% 0.0% 0.0% 78.41sec 7282930 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 ashamanes_rip ticks -210705 17137982 38084 20.03 85286 170722 19.1 150.3 33.7% 0.0% 0.0% 0.0% 21.92sec 17137982 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.06sec 0 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 cat_melee 0 13781214 30622 71.84 19131 38262 538.9 538.9 33.7% 0.0% 0.0% 0.0% 0.83sec 20259690 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 ferocious_bite 22568 3385925 7523 1.52 210167 465819 11.4 11.4 34.0% 0.0% 0.0% 0.0% 41.04sec 4977631 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 healing_touch 5185 0 0 0.00 0 0 51.7 0.0 0.0% 0.0% 0.0% 0.0% 8.79sec 0 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 infested_ground 221803 2377472 5283 10.34 22882 45755 7.9 77.6 33.9% 0.0% 0.0% 0.0% 60.70sec 2377472 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 lunar_inspiration 155625 1502984 3340 4.23 35349 70722 31.7 31.7 34.0% 0.0% 0.0% 0.0% 14.28sec 11219703 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 lunar_inspiration ticks -155625 9716719 21593 35.54 27240 54438 31.7 266.6 33.9% 0.0% 0.0% 0.0% 14.28sec 11219703 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 mark_of_the_distant_army ticks -191380 1043829 2320 10.09 13789 0 25.6 75.7 0.0% 0.0% 0.0% 0.0% 17.45sec 1534528 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 potion_of_the_old_war 188028 5248800 11663 3.34 156736 313395 25.1 25.1 33.7% 0.0% 0.0% 0.0% 16.16sec 7716233 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 rake 1822 5553951 12341 6.33 87538 174421 47.5 47.5 33.8% 0.0% 0.0% 0.0% 9.50sec 31966500 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 rake ticks -1822 26412549 58695 29.83 88285 176533 47.5 223.7 33.8% 0.0% 0.0% 0.0% 9.50sec 31966500 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 rip ticks -1079 38452103 85449 43.66 87732 175492 23.1 327.5 33.8% 0.0% 0.0% 0.0% 15.25sec 38452103 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 savage_roar 52610 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 24.40sec 0 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.39sec 0 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 shred 5221 14292600 31758 15.35 92735 185538 115.2 115.2 33.8% 0.0% 0.0% 0.0% 3.90sec 21011476 450.05sec
instinct_865 / pod_865 instinct_865 / pod_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.35sec 0 450.05sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.52% 9.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.34% 9.34% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.79% 9.79% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.70% 10.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.66% 10.66% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.66%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.30% 10.30% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.30%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.72% 10.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.96% 10.96% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.43% 10.43% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.43%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 7.59% 7.59% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:7.59%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 3479064.52
Combat End Resource Mean Min Max
Health 7023655.84 0.00 64624698.65

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 2499
Mean 450.05
Minimum 360.07
Maximum 539.96
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 2499
Mean 3497300.93
Minimum 3369335.93
Maximum 3623524.07
Spread ( max - min ) 254188.14
Range [ ( max - min ) / 2 * 100% ] 3.63%
Standard Deviation 40166.0531
5th Percentile 3430814.94
95th Percentile 3562960.82
( 95th Percentile - 5th Percentile ) 132145.89
Mean Distribution
Standard Deviation 803.4818
95.00% Confidence Intervall ( 3495726.14 - 3498875.73 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 5
0.1% Error 506
0.1 Scale Factor Error with Delta=300 13772157
0.05 Scale Factor Error with Delta=300 55088630
0.01 Scale Factor Error with Delta=300 1377215763
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 835
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1885402922 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.