close

SimulationCraft 703-03

for World of Warcraft 7.0.3 Live (wow build level 22522)

Current simulator hotfixes

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

baseline : 285600 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
285599.6 285599.6 380.4 / 0.133% 37544.3 / 13.1% 19748.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.5 14.5 Energy 31.29% 42.2 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
baseline 285600
Ashamane's Frenzy 13863 4.9% 6.1 78.84sec 1023940 1019493 Direct 91.1 9514 19032 12729 33.8%  
Periodic 30.1 125895 251565 168535 33.9% 17.4%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.09 91.11 121.23 30.12 1.0045 0.6472 6236241.70 6781431.56 8.04 73728.38 1019493.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.33 66.22% 9513.76 7081 11329 9516.67 8551 10486 573983 843810 31.98
crit 30.78 33.78% 19031.72 14161 22657 19034.48 16745 21109 585761 861125 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.9 66.08% 125894.67 78070 156132 125913.55 111544 139827 2505786 2505786 0.00
crit 10.2 33.92% 251564.61 156140 312264 251663.82 216837 286232 2570711 2570711 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 33068 11.6% 17.9 23.76sec 831218 0 Periodic 140.2 79322 158770 106151 33.8% 40.1%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.91 0.00 140.23 140.23 0.0000 1.2875 14886086.77 14886086.77 0.00 82449.93 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.9 66.23% 79322.42 55 94573 79258.21 69444 86512 7366758 7366758 0.00
crit 47.4 33.77% 158770.41 110 189146 158605.26 131147 179165 7519329 7519329 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 26707 9.4% 493.3 0.91sec 24351 26772 Direct 493.3 18194 36393 24352 33.8%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 493.28 493.28 0.00 0.00 0.9096 0.0000 12012105.00 17658932.17 31.98 26771.92 26771.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 326.39 66.17% 18194.01 14216 20436 18193.44 17864 18485 5938419 8730038 31.98
crit 166.89 33.83% 36393.47 28433 40872 36392.24 35419 37161 6073686 8928894 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 5656 2.0% 9.9 48.21sec 256886 255756 Direct 9.9 183298 403119 256984 33.5%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.88 9.88 0.00 0.00 1.0045 0.0000 2538637.59 3732037.72 31.98 255756.36 255756.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.57 66.50% 183297.97 14703 251221 182867.23 0 251221 1204608 1770888 31.96
crit 3.31 33.50% 403118.69 32218 555198 392107.42 0 555198 1334029 1961149 31.18
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 21414 7.5% 31.6 14.37sec 305207 303848 Direct 31.6 32983 65948 44101 33.7%  
Periodic 242.1 25449 50918 34044 33.7% 96.7%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.56 31.56 242.07 242.07 1.0045 1.7978 9632891.28 9632891.28 0.00 20632.39 303847.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.92 66.27% 32982.88 25727 36982 32980.50 30229 34756 689910 689910 0.00
crit 10.64 33.73% 65947.63 51454 73964 65928.62 57885 72586 701974 701974 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 160.4 66.25% 25449.27 134 28764 25448.93 24688 26077 4081326 4081326 0.00
crit 81.7 33.75% 50917.97 1204 57529 50916.87 48786 52507 4159681 4159681 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2123 0.7% 23.5 18.78sec 40663 0 Periodic 69.4 13749 0 13749 0.0% 7.7%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.48 0.00 69.43 69.43 0.0000 0.4972 954614.44 1403373.65 31.98 27653.95 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.4 100.00% 13749.22 27 15493 13751.01 12667 14581 954614 1403374 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 10805 3.7% 22.9 17.71sec 209424 0 Direct 22.9 156406 313147 209417 33.8%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.92 22.92 0.00 0.00 0.0000 0.0000 4799578.26 7055834.68 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.17 66.17% 156406.30 122075 175482 156374.84 142217 170904 2371849 3486842 31.98
crit 7.75 33.83% 313147.10 244149 350964 313009.31 264495 350964 2427730 3568993 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 65540 23.0% 46.9 9.65sec 629087 626280 Direct 46.9 81166 163120 108881 33.8%  
Periodic 223.4 81590 162906 109117 33.9% 94.5%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.87 46.87 223.44 223.44 1.0045 1.9031 29482758.71 29482758.71 0.00 62423.13 626280.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.01 66.18% 81165.56 38283 183748 81183.22 70617 92239 2517315 2517315 0.00
crit 15.85 33.82% 163119.70 76565 367495 163155.72 127741 219642 2585690 2585690 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 147.8 66.15% 81590.13 36 183748 81619.21 73987 93688 12059141 12059141 0.00
crit 75.6 33.85% 162905.54 152 367495 162965.94 132476 189619 12320613 12320613 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 78616 27.6% 22.6 15.91sec 1564893 1557910 Periodic 324.8 81478 162957 108964 33.7% 95.4%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.61 0.00 324.77 324.77 1.0045 1.3223 35386375.39 35386375.39 0.00 78263.33 1557910.34
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 215.2 66.27% 81478.04 55 94573 81466.28 75508 85762 17535585 17535585 0.00
crit 109.5 33.73% 162957.18 123 189146 162948.59 149671 172584 17850791 17850791 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 27806 9.7% 105.6 4.25sec 118268 117739 Direct 105.6 88410 176796 118271 33.8%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.64 105.64 0.00 0.00 1.0045 0.0000 12493602.75 18366779.46 31.98 117738.66 117738.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.95 66.22% 88410.41 61977 133637 88418.05 83069 94016 6184335 9091559 31.98
crit 35.69 33.78% 176795.51 123954 267275 176717.11 158091 195876 6309267 9275221 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
baseline
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.00sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Healing Touch 48.9 9.32sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 48.90 0.00 0.00 0.00 0.8984 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.4 25.03sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.35 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.62sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.33sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.19% 45.4(45.4) 15.1

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.80% 15.26% 0.0(0.0) 2.9

Buff details

  • buff initial source:baseline
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 48.9 0.0 9.3sec 9.3sec 45.58% 45.61% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:19.18%
  • bloodtalons_2:26.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 42.0 1.1 10.5sec 10.2sec 5.94% 15.07% 1.1(1.1) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:5.94%

Trigger Attempt Success

  • trigger_pct:8.76%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.8 64.6sec 49.4sec 24.33% 24.42% 1.8(1.8) 6.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.6sec 0.0sec 10.81% 10.91% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 48.6 1.3 9.2sec 9.0sec 74.42% 74.43% 1.3(1.3) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.42%

Trigger Attempt Success

  • trigger_pct:98.14%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.8 9.5 45.4sec 25.0sec 92.42% 92.18% 201.3(201.3) 7.8

Buff details

  • buff initial source:baseline
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:92.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.7sec 133.7sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.82% 29.26% 0.0(0.0) 14.9

Buff details

  • buff initial source:baseline
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
baseline
ferocious_bite Energy 19.8 330.6 16.7 33.5 7679.1
ferocious_bite Combo Points 9.9 44.7 4.5 4.5 56795.5
lunar_inspiration Energy 31.6 785.1 24.9 24.9 12270.4
rake Energy 46.9 1335.6 28.5 28.5 22074.4
rip Energy 22.6 465.0 20.6 20.6 76091.9
rip Combo Points 22.6 113.1 5.0 5.0 312955.6
savage_roar Energy 18.4 476.4 26.0 26.0 0.0
savage_roar Combo Points 18.4 91.8 5.0 5.0 0.0
shred Energy 105.6 3110.2 29.4 29.4 4016.9
Resource Gains Type Count Total Average Overflow
rake Combo Points 46.87 46.87 (18.55%) 1.00 0.00 0.00%
tigers_fury Energy 15.21 912.25 (11.56%) 59.97 0.46 0.05%
ashamanes_frenzy Combo Points 6.09 18.27 (7.23%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.56 31.56 (12.49%) 1.00 0.00 0.00%
shred Combo Points 105.64 105.64 (41.80%) 1.00 0.00 0.00%
energy_regen Energy 1947.18 4880.71 (61.83%) 2.51 59.84 1.21%
clearcasting Energy 41.98 1437.17 (18.21%) 34.23 0.00 0.00%
ashamanes_energy Energy 45.44 663.75 (8.41%) 14.61 17.87 2.62%
primal_fury Combo Points 62.18 50.36 (19.93%) 0.81 11.83 19.02%
Resource RPS-Gain RPS-Loss
Energy 14.35 14.45
Combo Points 0.56 0.55
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 35.56 0.13 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.08 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.7%

Procs

Count Interval
clearcasting 43.2 10.2sec
clearcasting_wasted 1.1 129.3sec
primal_fury 62.2 7.2sec

Statistics & Data Analysis

Fight Length
Sample Data Druid_Feral_T19P Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Druid_Feral_T19P Damage Per Second
Count 2499
Mean 285599.63
Minimum 252685.41
Maximum 318279.62
Spread ( max - min ) 65594.22
Range [ ( max - min ) / 2 * 100% ] 11.48%
Standard Deviation 9702.7026
5th Percentile 269713.05
95th Percentile 302025.53
( 95th Percentile - 5th Percentile ) 32312.47
Mean Distribution
Standard Deviation 194.0929
95.00% Confidence Intervall ( 285219.22 - 285980.05 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4433
0.1 Scale Factor Error with Delta=300 803653
0.05 Scale Factor Error with Delta=300 3214615
0.01 Scale Factor Error with Delta=300 80365399
Priority Target DPS
Sample Data Druid_Feral_T19P Priority Target Damage Per Second
Count 2499
Mean 285599.63
Minimum 252685.41
Maximum 318279.62
Spread ( max - min ) 65594.22
Range [ ( max - min ) / 2 * 100% ] 11.48%
Standard Deviation 9702.7026
5th Percentile 269713.05
95th Percentile 302025.53
( 95th Percentile - 5th Percentile ) 32312.47
Mean Distribution
Standard Deviation 194.0929
95.00% Confidence Intervall ( 285219.22 - 285980.05 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4433
0.1 Scale Factor Error with Delta=300 803653
0.05 Scale Factor Error with Delta=300 3214615
0.01 Scale Factor Error with Delta=300 80365399
DPS(e)
Sample Data Druid_Feral_T19P Damage Per Second (Effective)
Count 2499
Mean 285599.63
Minimum 252685.41
Maximum 318279.62
Spread ( max - min ) 65594.22
Range [ ( max - min ) / 2 * 100% ] 11.48%
Damage
Sample Data Druid_Feral_T19P Damage
Count 2499
Mean 128422891.88
Minimum 91994670.09
Maximum 161371108.42
Spread ( max - min ) 69376438.33
Range [ ( max - min ) / 2 * 100% ] 27.01%
DTPS
Sample Data Druid_Feral_T19P Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Druid_Feral_T19P Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Druid_Feral_T19P Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Druid_Feral_T19P Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Druid_Feral_T19P Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Druid_Feral_T19P Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Druid_Feral_T19PTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Druid_Feral_T19P Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.56 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.56 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.21 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 4.22 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 47.90 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.83 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.61 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 9.52 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 5.66 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.09 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.56 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.30 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.56 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 105.64 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQQCAQIQQEMJOPQQQELOQQQQEJOPQEICN89QQQEJPQQEKOQPQEJOCQQQPEJOQQEKQOQPEJMOEKCOPQQEJOQQPEJOQQQEKOPCQEJQQQQEKOPOEJQQPCQEJN89QQPQEIMOQEJOCAPQQEJOQQQEIPOQELQQQQEJOPQCQEJOQQPEIOQQEJOPCQQEJMOQEIOPQEJOQPQEKCOQQQEJOPQQEJOPQEICN89QQEJPQQEKOQEMJPOQQCEJOQPQEKOQQPDQOEOCABPKQQDQQQQELOQQELOPQEOCIPQDQEMOKPDQOQCEN89LPQQQEKQOP

Sample Sequence Table

time name target resources buffs
Pre flask baseline 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food baseline 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation baseline 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.003 lunar_inspiration Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, bloodtalons, potion_of_the_old_war
0:02.007 shred Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:03.011 shred Fluffy_Pillow 63.9/100: 64% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, potion_of_the_old_war
0:04.015 tigers_fury Fluffy_Pillow 37.9/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, potion_of_the_old_war
0:04.015 berserk Fluffy_Pillow 97.9/100: 98% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:04.015 shred Fluffy_Pillow 97.9/150: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:05.019 savage_roar Fluffy_Pillow 106.8/150: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:06.024 shred Fluffy_Pillow 115.8/150: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:07.029 shred Fluffy_Pillow 124.8/150: 83% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:08.035 healing_touch Fluffy_Pillow 138.8/150: 93% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:08.788 ashamanes_frenzy Fluffy_Pillow 149.2/150: 99% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:09.793 rip Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:10.797 rake Fluffy_Pillow 149.0/150: 99% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:11.801 lunar_inspiration Fluffy_Pillow 145.4/150: 97% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:12.806 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:13.810 shred Fluffy_Pillow 144.0/150: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:14.815 shred Fluffy_Pillow 137.9/150: 92% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:15.819 healing_touch Fluffy_Pillow 131.9/150: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.573 ferocious_bite Fluffy_Pillow 142.4/150: 95% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
0:17.578 rake Fluffy_Pillow 143.9/150: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.581 shred Fluffy_Pillow 140.3/150: 94% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:19.586 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.591 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:21.595 shred Fluffy_Pillow 74.0/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.598 healing_touch Fluffy_Pillow 47.9/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.353 Waiting 2.000 sec 58.4/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:25.353 rip Fluffy_Pillow 86.2/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:26.357 rake Fluffy_Pillow 70.2/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:27.361 lunar_inspiration Fluffy_Pillow 49.2/100: 49% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:28.365 Waiting 0.500 sec 33.1/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:28.865 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:29.870 healing_touch Fluffy_Pillow 14.1/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness
0:31.905 savage_roar Fluffy_Pillow 42.4/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2)
0:33.926 tigers_fury Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:34.015 shadowmeld Fluffy_Pillow 91.7/100: 92% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.015 rake Fluffy_Pillow 91.7/100: 92% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.015 auto_attack Fluffy_Pillow 56.7/100: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.018 shred Fluffy_Pillow 85.7/100: 86% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.022 shred Fluffy_Pillow 74.7/100: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:37.025 shred Fluffy_Pillow 63.6/100: 64% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:38.029 healing_touch Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:38.783 Waiting 1.000 sec 48.1/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:39.783 rip Fluffy_Pillow 62.0/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, tigers_fury
0:40.789 lunar_inspiration Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:41.793 shred Fluffy_Pillow 56.7/100: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:42.797 Waiting 1.200 sec 27.5/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:43.997 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:45.002 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:45.941 Waiting 1.864 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:47.805 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:48.810 rake Fluffy_Pillow 51.8/100: 52% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:49.815 Waiting 1.200 sec 27.6/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
0:51.015 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
0:52.020 Waiting 1.794 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:53.814 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:54.818 Waiting 2.799 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:57.617 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:58.621 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:59.560 Waiting 0.796 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:00.356 rip Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:03.659 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:04.664 tigers_fury Fluffy_Pillow 11.4/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
1:04.664 shred Fluffy_Pillow 71.4/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:05.669 shred Fluffy_Pillow 97.2/100: 97% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:06.674 shred Fluffy_Pillow 83.0/100: 83% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:07.677 lunar_inspiration Fluffy_Pillow 68.7/100: 69% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:08.682 healing_touch Fluffy_Pillow 79.4/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:09.621 rip Fluffy_Pillow 89.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
1:10.625 rake Fluffy_Pillow 70.2/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:11.629 shred Fluffy_Pillow 46.0/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:12.633 Waiting 0.773 sec 16.7/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:13.406 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
1:14.409 healing_touch Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
1:15.348 savage_roar Fluffy_Pillow 45.8/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
1:16.354 shred Fluffy_Pillow 56.5/100: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
1:17.359 rake Fluffy_Pillow 27.3/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:18.362 Waiting 0.200 sec 38.0/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:18.562 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:19.566 Waiting 1.816 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:21.382 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:22.385 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:23.323 Waiting 5.663 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:28.986 rip Fluffy_Pillow 81.7/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:29.989 ashamanes_frenzy Fluffy_Pillow 62.4/100: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:30.992 rake Fluffy_Pillow 73.2/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:31.997 healing_touch Fluffy_Pillow 48.9/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:32.935 savage_roar Fluffy_Pillow 59.0/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:33.941 Waiting 0.100 sec 29.7/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:34.550 tigers_fury Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
1:34.664 rake Fluffy_Pillow 97.5/100: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.667 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:36.671 shred Fluffy_Pillow 95.7/100: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:37.676 shred Fluffy_Pillow 81.5/100: 81% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
1:38.681 healing_touch Fluffy_Pillow 52.3/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:39.620 Waiting 2.600 sec 62.3/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:42.220 rip Fluffy_Pillow 90.1/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:43.225 rake Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:44.230 shred Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:45.235 Waiting 2.211 sec 17.4/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:47.446 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:48.451 Waiting 1.233 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:49.684 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
1:50.688 healing_touch Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:51.627 Waiting 3.200 sec 45.8/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:54.827 rip Fluffy_Pillow 80.0/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:55.832 rake Fluffy_Pillow 60.8/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:56.838 Waiting 0.400 sec 36.5/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:57.238 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:58.245 Waiting 1.252 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:59.497 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
2:00.502 shred Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
2:01.505 healing_touch Fluffy_Pillow 46.5/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:02.442 savage_roar Fluffy_Pillow 56.5/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:03.447 rake Fluffy_Pillow 67.3/100: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:04.451 lunar_inspiration Fluffy_Pillow 43.0/100: 43% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:05.456 tigers_fury Fluffy_Pillow 23.8/100: 24% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar
2:05.456 shred Fluffy_Pillow 83.8/100: 84% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:06.461 healing_touch Fluffy_Pillow 69.5/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:07.399 Waiting 0.100 sec 79.6/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:07.499 rip Fluffy_Pillow 95.6/100: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:08.502 shred Fluffy_Pillow 91.4/100: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:09.507 shred Fluffy_Pillow 62.1/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:10.512 Waiting 0.700 sec 32.9/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
2:11.212 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
2:12.218 Waiting 2.797 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
2:15.015 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:16.018 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
2:16.955 Waiting 0.698 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:17.653 savage_roar Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:18.657 rake Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:19.661 Waiting 1.363 sec 15.8/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:21.024 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:24.331 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:25.334 healing_touch Fluffy_Pillow 11.5/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:26.272 Waiting 2.226 sec 21.5/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:28.498 rip Fluffy_Pillow 45.3/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:29.503 Waiting 0.100 sec 26.1/100: 26% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:29.603 shred Fluffy_Pillow 27.1/100: 27% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
2:30.607 Waiting 0.200 sec 37.9/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:30.807 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:31.811 Waiting 1.829 sec 10.8/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:33.640 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:34.645 Waiting 1.298 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:35.943 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:35.943 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:36.947 healing_touch Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:37.885 rip Fluffy_Pillow 80.8/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:38.891 shadowmeld Fluffy_Pillow 76.5/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:38.891 rake Fluffy_Pillow 76.5/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:38.891 auto_attack Fluffy_Pillow 41.5/100: 42% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:39.896 shred Fluffy_Pillow 67.3/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
2:40.900 Waiting 0.200 sec 38.0/100: 38% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:41.100 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
2:42.104 Waiting 2.816 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
2:44.920 lunar_inspiration Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:45.924 Waiting 1.799 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:47.723 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:48.725 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:51.449 savage_roar Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
2:52.454 ashamanes_frenzy Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:54.737 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
2:55.743 Waiting 2.727 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:58.470 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:59.475 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:00.415 Waiting 0.793 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:01.208 rip Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:04.511 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:05.515 Waiting 1.268 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:06.783 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:06.783 berserk Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:06.783 lunar_inspiration Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:07.787 shred Fluffy_Pillow 95.7/150: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:08.790 shred Fluffy_Pillow 101.5/150: 68% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:09.795 healing_touch Fluffy_Pillow 127.2/150: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:10.733 rip Fluffy_Pillow 137.3/150: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury
3:11.738 rake Fluffy_Pillow 133.0/150: 89% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury
3:12.743 shred Fluffy_Pillow 143.8/150: 96% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:13.747 shred Fluffy_Pillow 134.5/150: 90% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury
3:14.752 shred Fluffy_Pillow 145.3/150: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:15.755 healing_touch Fluffy_Pillow 136.0/150: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness
3:16.693 savage_roar Fluffy_Pillow 146.0/150: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk
3:17.696 lunar_inspiration Fluffy_Pillow 136.8/150: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar
3:18.700 rake Fluffy_Pillow 132.5/150: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons(2), berserk, predatory_swiftness, savage_roar
3:19.704 shred Fluffy_Pillow 143.3/150: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:20.709 healing_touch Fluffy_Pillow 134.0/150: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:21.649 ferocious_bite Fluffy_Pillow 144.1/150: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar
3:22.654 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:23.657 shred Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
3:24.662 shred Fluffy_Pillow 81.5/100: 81% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:25.666 shred Fluffy_Pillow 52.2/100: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:26.672 healing_touch Fluffy_Pillow 23.0/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:27.609 Waiting 2.700 sec 33.0/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:30.309 rip Fluffy_Pillow 61.9/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:31.315 rake Fluffy_Pillow 42.7/100: 43% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:32.320 Waiting 0.813 sec 18.4/100: 18% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:33.133 lunar_inspiration Fluffy_Pillow 27.1/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
3:34.138 Waiting 0.200 sec 37.9/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:34.338 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:35.341 Waiting 1.330 sec 10.8/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:36.671 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:36.783 shred Fluffy_Pillow 86.2/100: 86% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:37.787 healing_touch Fluffy_Pillow 71.9/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:38.726 Waiting 0.100 sec 82.0/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
3:38.826 rip Fluffy_Pillow 98.1/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
3:39.830 rake Fluffy_Pillow 93.8/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:40.833 shred Fluffy_Pillow 69.5/100: 70% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury, jacins_ruse
3:41.839 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury, jacins_ruse
3:42.845 Waiting 1.803 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury, jacins_ruse
3:44.648 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury, jacins_ruse
3:45.653 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, jacins_ruse
3:48.382 savage_roar Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
3:51.685 rake Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
3:52.690 shred Fluffy_Pillow 11.4/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
3:53.694 Waiting 1.766 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:55.460 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:56.465 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:57.401 Waiting 2.397 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:59.798 rip Fluffy_Pillow 47.5/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:01.572 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:02.575 Waiting 1.698 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:04.273 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:05.279 Waiting 1.297 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:06.576 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:06.783 shred Fluffy_Pillow 87.2/100: 87% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:07.787 shred Fluffy_Pillow 73.0/100: 73% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:08.792 healing_touch Fluffy_Pillow 58.7/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
4:09.732 Waiting 0.600 sec 68.8/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:10.332 rip Fluffy_Pillow 90.2/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:11.338 ashamanes_frenzy Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:12.344 rake Fluffy_Pillow 81.7/100: 82% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:13.350 shred Fluffy_Pillow 57.5/100: 57% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
4:14.354 healing_touch Fluffy_Pillow 28.2/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
4:15.551 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
4:17.068 rake Fluffy_Pillow 17.3/100: 17% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
4:18.074 Waiting 0.200 sec 28.0/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:18.274 lunar_inspiration Fluffy_Pillow 30.2/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:19.280 Waiting 2.414 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
4:21.694 shred Fluffy_Pillow 36.8/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:22.697 healing_touch Fluffy_Pillow 47.5/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:23.638 Waiting 0.800 sec 57.6/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:24.438 rip Fluffy_Pillow 66.1/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:25.443 rake Fluffy_Pillow 76.9/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:26.449 shred Fluffy_Pillow 52.6/100: 53% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:27.452 Waiting 0.651 sec 23.4/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:28.103 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:29.108 Waiting 2.799 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:31.907 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:32.911 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:33.847 Waiting 1.798 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:35.645 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:36.649 tigers_fury Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:36.783 rake Fluffy_Pillow 73.2/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:37.788 shred Fluffy_Pillow 64.0/100: 64% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:38.792 shred Fluffy_Pillow 49.7/100: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:39.795 Waiting 0.500 sec 35.5/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:40.295 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:41.299 healing_touch Fluffy_Pillow 11.5/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:42.238 Waiting 3.117 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:45.355 rip Fluffy_Pillow 55.0/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:46.360 rake Fluffy_Pillow 65.7/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:47.365 lunar_inspiration Fluffy_Pillow 41.5/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
4:48.368 shred Fluffy_Pillow 52.2/100: 52% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:49.373 Waiting 1.691 sec 22.9/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:51.064 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:52.070 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:53.008 Waiting 4.194 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:57.202 rip Fluffy_Pillow 66.7/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:58.207 rake Fluffy_Pillow 47.5/100: 47% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:59.212 Waiting 0.665 sec 23.2/100: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:59.877 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:00.881 Waiting 1.299 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:02.180 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:03.184 healing_touch Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:04.123 savage_roar Fluffy_Pillow 45.8/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
5:06.660 tigers_fury Fluffy_Pillow 32.9/100: 33% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:06.783 shadowmeld Fluffy_Pillow 94.2/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:06.783 rake Fluffy_Pillow 94.2/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:06.783 auto_attack Fluffy_Pillow 59.2/100: 59% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:07.788 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:08.793 shred Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:09.798 healing_touch Fluffy_Pillow 56.5/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
5:10.737 rip Fluffy_Pillow 66.6/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
5:11.740 lunar_inspiration Fluffy_Pillow 77.3/100: 77% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:12.744 shred Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:13.749 Waiting 1.100 sec 28.8/100: 29% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:14.849 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:15.852 healing_touch Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:16.790 Waiting 1.843 sec 21.3/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:18.633 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:21.940 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:22.945 Waiting 1.597 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:24.542 shred Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:25.547 healing_touch Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:26.486 ashamanes_frenzy Fluffy_Pillow 50.1/100: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), savage_roar
5:27.489 Waiting 2.700 sec 60.8/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:30.189 rip Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:31.193 lunar_inspiration Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:32.198 rake Fluffy_Pillow 51.2/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:33.204 Waiting 1.300 sec 27.0/100: 27% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:34.504 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:35.510 Waiting 1.248 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:36.758 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
5:37.762 tigers_fury Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:37.762 healing_touch Fluffy_Pillow 95.7/100: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:38.700 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
5:39.704 rake Fluffy_Pillow 95.7/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:40.708 shred Fluffy_Pillow 86.5/100: 86% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:41.712 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:42.717 shred Fluffy_Pillow 80.8/100: 81% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:43.722 healing_touch Fluffy_Pillow 51.5/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:44.658 Waiting 2.600 sec 61.5/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
5:47.258 savage_roar Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:48.263 rake Fluffy_Pillow 60.1/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:49.269 Waiting 0.400 sec 35.9/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:49.669 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:50.673 Waiting 2.818 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:53.491 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:54.495 Waiting 1.234 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:55.729 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:56.733 ferocious_bite Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:57.737 Waiting 2.832 sec 10.7/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
6:00.569 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
6:03.872 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:04.876 Waiting 2.402 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:07.278 healing_touch Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:08.218 rake Fluffy_Pillow 47.9/100: 48% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar
6:09.221 tigers_fury Fluffy_Pillow 23.6/100: 24% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar
6:09.221 berserk Fluffy_Pillow 83.6/100: 84% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
6:09.221 potion Fluffy_Pillow 83.6/150: 56% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury
6:09.221 lunar_inspiration Fluffy_Pillow 83.6/150: 56% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:10.229 savage_roar Fluffy_Pillow 94.4/150: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:11.235 shred Fluffy_Pillow 100.2/150: 67% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:12.240 shred Fluffy_Pillow 105.9/150: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:13.244 ferocious_bite Fluffy_Pillow 96.7/150: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:14.249 shred Fluffy_Pillow 82.4/150: 55% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:15.252 shred Fluffy_Pillow 73.2/150: 49% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:16.258 shred Fluffy_Pillow 63.9/150: 43% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:17.263 shred Fluffy_Pillow 54.7/150: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:18.265 healing_touch Fluffy_Pillow 45.4/150: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:19.204 ferocious_bite Fluffy_Pillow 55.5/150: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:20.208 rake Fluffy_Pillow 41.2/150: 27% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:21.213 shred Fluffy_Pillow 34.5/150: 23% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:22.218 shred Fluffy_Pillow 25.2/150: 17% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:23.221 healing_touch Fluffy_Pillow 15.9/150: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:24.158 ferocious_bite Fluffy_Pillow 26.0/150: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:27.463 rake Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:28.467 Waiting 1.708 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:30.175 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:31.178 Waiting 2.800 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:33.978 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:34.981 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:37.196 rake Fluffy_Pillow 35.5/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar
6:39.223 tigers_fury Fluffy_Pillow 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons
6:39.223 savage_roar Fluffy_Pillow 82.2/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, tigers_fury
6:40.228 lunar_inspiration Fluffy_Pillow 67.9/100: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:41.234 shred Fluffy_Pillow 63.7/100: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:42.236 ferocious_bite Fluffy_Pillow 49.4/100: 49% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
6:43.241 Waiting 2.831 sec 10.8/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
6:46.072 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
6:47.077 Waiting 2.733 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
6:49.810 healing_touch Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:50.748 ashamanes_frenzy Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), savage_roar
6:51.754 rake Fluffy_Pillow 61.8/100: 62% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar
6:52.759 Waiting 4.900 sec 37.6/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points savage_roar
6:57.659 savage_roar Fluffy_Pillow 90.0/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points savage_roar
6:58.664 lunar_inspiration Fluffy_Pillow 60.8/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
6:59.668 ferocious_bite Fluffy_Pillow 41.5/100: 42% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:00.673 shred Fluffy_Pillow 10.8/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar
7:01.677 Waiting 0.327 sec 21.5/100: 21% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:03.026 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:04.031 Waiting 2.744 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:06.775 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:07.780 Waiting 1.233 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:09.013 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:09.223 healing_touch Fluffy_Pillow 87.2/100: 87% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:10.161 shadowmeld Fluffy_Pillow 97.3/100: 97% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
7:10.161 rake Fluffy_Pillow 97.3/100: 97% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points shadowmeld, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
7:10.161 auto_attack Fluffy_Pillow 62.3/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
7:11.166 Waiting 0.100 sec 88.0/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
7:11.266 ferocious_bite Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
7:12.270 lunar_inspiration Fluffy_Pillow 75.7/100: 76% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury
7:13.276 shred Fluffy_Pillow 56.5/100: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
7:14.282 shred Fluffy_Pillow 67.3/100: 67% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
7:15.288 Waiting 0.200 sec 38.0/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
7:15.488 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
7:16.494 healing_touch Fluffy_Pillow 10.9/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
7:17.431 Waiting 4.276 sec 21.0/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:21.707 savage_roar Fluffy_Pillow 66.7/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:22.712 Waiting 0.300 sec 37.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:23.012 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:26.317 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:27.323 Waiting 1.731 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:29.054 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 33.77% 33.77% 6220
Haste 7.01% 7.01% 2277
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 21649 19943 0
Mastery 51.70% 49.54% 5871
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 844.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="baseline"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=844.29
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=6220
# gear_haste_rating=1518
# gear_mastery_rating=5871
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

bloodthirsty_instinct_865 : 311768 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
311768.1 311768.1 395.3 / 0.127% 38722.1 / 12.4% 20850.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.9 14.9 Energy 30.51% 43.3 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
bloodthirsty_instinct_865 311768
Ashamane's Frenzy 14841 4.8% 6.1 78.45sec 1093555 1088749 Direct 91.3 10169 20337 13591 33.6%  
Periodic 30.2 134520 269043 179934 33.8% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.11 91.35 121.56 30.21 1.0045 0.6474 6677295.91 7260864.36 8.04 78720.35 1088748.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.61 66.36% 10169.08 7568 12108 10170.85 9057 11326 616386 906145 31.98
crit 30.73 33.64% 20336.56 15135 24215 20339.66 17855 22678 624999 918808 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.0 66.24% 134520.46 83438 166868 134536.63 118440 150144 2691957 2691957 0.00
crit 10.2 33.76% 269042.79 166876 333736 269076.34 237278 314920 2743954 2743954 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 36973 11.9% 18.6 22.88sec 896409 0 Periodic 146.1 85169 170417 113947 33.8% 41.9%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.57 0.00 146.10 146.10 0.0000 1.2897 16647958.55 16647958.55 0.00 88350.89 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.8 66.25% 85169.48 59 101078 85093.89 75694 92393 8243532 8243532 0.00
crit 49.3 33.75% 170416.90 118 202156 170276.66 144969 188772 8404426 8404426 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 29430 9.4% 517.8 0.87sec 25567 29580 Direct 517.8 19104 38195 25566 33.9%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 517.81 517.81 0.00 0.00 0.8643 0.0000 13238675.06 19462106.34 31.98 29579.73 29579.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 342.52 66.15% 19103.96 14889 21403 19103.22 18605 19400 6543400 9619418 31.98
crit 175.29 33.85% 38194.65 29778 42805 38193.39 36912 39118 6695275 9842689 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6851 2.2% 10.7 44.06sec 287494 286218 Direct 10.7 204390 452195 287581 33.5%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.70 10.70 0.00 0.00 1.0045 0.0000 3077420.00 4524098.90 31.98 286218.38 286218.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.11 66.45% 204389.97 15618 268499 204153.61 108861 258658 1453866 2137321 31.98
crit 3.59 33.55% 452195.30 35819 593384 443063.59 0 593384 1623554 2386778 31.54
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 23957 7.7% 31.6 14.32sec 340764 339239 Direct 31.6 35284 70578 47155 33.6%  
Periodic 255.6 27163 54348 36328 33.7% 96.9%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.63 31.63 255.64 255.64 1.0045 1.7065 10778308.78 10778308.78 0.00 23029.34 339239.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.99 66.36% 35283.76 27496 39526 35279.23 33153 37234 740545 740545 0.00
crit 10.64 33.64% 70577.94 54992 79051 70573.84 62063 77333 751044 751044 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 169.5 66.29% 27162.86 29 30743 27161.56 25800 27877 4602918 4602918 0.00
crit 86.2 33.71% 54347.88 64 61485 54346.77 51743 56941 4683802 4683802 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2232 0.7% 24.7 17.99sec 40660 0 Periodic 73.0 13764 0 13764 0.0% 8.1%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.70 0.00 72.96 72.96 0.0000 0.4969 1004256.08 1476351.56 31.98 27700.56 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.0 100.00% 13764.33 27 15493 13766.29 12871 14482 1004256 1476352 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11366 3.6% 24.1 16.95sec 209573 0 Direct 24.1 156627 313111 209572 33.8%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.07 24.07 0.00 0.00 0.0000 0.0000 5045024.89 7416664.46 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.93 66.17% 156627.48 122075 175482 156607.56 143765 167852 2494846 3667659 31.98
crit 8.14 33.83% 313111.22 244149 350964 313170.17 268564 350964 2550179 3749005 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 70716 22.7% 47.3 9.54sec 673219 670208 Direct 47.3 87160 174567 116819 33.9%  
Periodic 223.7 87740 175747 117529 33.8% 94.9%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.26 47.26 223.72 223.72 1.0045 1.9093 31813438.96 31813438.96 0.00 67030.98 670208.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.22 66.07% 87159.56 40916 196385 87181.21 73236 98435 2721179 2721179 0.00
crit 16.04 33.93% 174566.64 81831 392770 174503.61 137067 227712 2799175 2799175 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.0 66.15% 87740.09 38 196385 87760.69 78907 96702 12985447 12985447 0.00
crit 75.7 33.85% 175747.22 76 392770 175750.22 150732 203012 13307638 13307638 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 84821 27.2% 22.9 15.45sec 1670914 1663486 Periodic 326.3 87545 175060 117049 33.7% 96.1%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.86 0.00 326.27 326.27 1.0045 1.3247 38190306.77 38190306.77 0.00 83901.36 1663485.79
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 216.3 66.29% 87544.92 68 101078 87528.40 81479 91935 18933493 18933493 0.00
crit 110.0 33.71% 175060.08 136 202156 175021.38 162746 186729 19256813 19256813 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 30580 9.8% 110.8 4.06sec 124072 123517 Direct 110.8 92673 185323 124069 33.9%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.77 110.77 0.00 0.00 1.0045 0.0000 13742820.57 20203248.00 31.98 123516.54 123516.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.23 66.11% 92673.16 64908 139959 92689.38 87584 98920 6786336 9976557 31.98
crit 37.54 33.89% 185323.07 129817 279918 185269.28 170385 206292 6956484 10226691 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
bloodthirsty_instinct_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:bloodthirsty_instinct_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 181.99sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:bloodthirsty_instinct_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:bloodthirsty_instinct_865
  • harmful:false
  • if_expr:
 
Healing Touch 50.4 9.03sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.42 0.00 0.00 0.00 0.8615 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.6 24.66sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.58 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 132.64sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.34sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.18% 45.4(45.4) 15.1

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 14.84% 0.0(0.0) 2.9

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Blood Frenzy 14.5 7.8 30.9sec 19.7sec 40.19% 40.25% 7.8(7.8) 14.1

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2902.15

Stack Uptimes

  • blood_frenzy_1:40.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 7.55% 0.0(0.0) 1.0

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 50.4 0.0 9.0sec 9.0sec 45.65% 45.69% 0.0(0.0) 0.0

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.75%
  • bloodtalons_2:26.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 43.9 1.4 10.1sec 9.8sec 6.35% 15.27% 1.4(1.4) 0.0

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.35%

Trigger Attempt Success

  • trigger_pct:8.75%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.7 1.9 63.7sec 48.1sec 24.83% 24.92% 1.9(1.9) 6.4

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.3sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 50.1 1.2 8.9sec 8.7sec 74.53% 74.54% 1.2(1.2) 0.0

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.53%

Trigger Attempt Success

  • trigger_pct:98.47%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.2 10.4 48.0sec 24.7sec 93.40% 93.17% 201.7(201.7) 7.2

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.1sec 133.1sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.81% 29.07% 0.0(0.0) 14.9

Buff details

  • buff initial source:bloodthirsty_instinct_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
bloodthirsty_instinct_865
ferocious_bite Energy 21.4 363.9 17.0 34.0 8456.1
ferocious_bite Combo Points 10.7 49.5 4.6 4.6 62128.0
lunar_inspiration Energy 31.6 784.5 24.8 24.8 13739.0
rake Energy 47.3 1344.1 28.4 28.4 23669.6
rip Energy 22.9 466.4 20.4 20.4 81886.9
rip Combo Points 22.9 114.3 5.0 5.0 334168.5
savage_roar Energy 18.6 480.9 25.9 25.9 0.0
savage_roar Combo Points 18.6 92.9 5.0 5.0 0.0
shred Energy 110.8 3285.2 29.7 29.7 4183.3
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.26 47.26 (18.18%) 1.00 0.00 0.00%
tigers_fury Energy 15.21 912.31 (11.15%) 59.97 0.52 0.06%
ashamanes_frenzy Combo Points 6.11 18.32 (7.05%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.63 31.63 (12.17%) 1.00 0.00 0.00%
shred Combo Points 110.77 110.77 (42.61%) 1.00 0.00 0.00%
energy_regen Energy 2006.27 5112.39 (62.46%) 2.55 77.46 1.49%
clearcasting Energy 43.86 1498.98 (18.31%) 34.18 0.00 0.00%
ashamanes_energy Energy 45.44 661.61 (8.08%) 14.56 20.02 2.94%
primal_fury Combo Points 64.21 51.99 (20.00%) 0.81 12.22 19.03%
Resource RPS-Gain RPS-Loss
Energy 14.86 14.94
Combo Points 0.58 0.57
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 38.28 0.04 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.22 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.9%

Procs

Count Interval
clearcasting 45.3 9.8sec
clearcasting_wasted 1.4 120.3sec
primal_fury 64.2 7.0sec

Statistics & Data Analysis

Fight Length
Sample Data bloodthirsty_instinct_865 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data bloodthirsty_instinct_865 Damage Per Second
Count 2499
Mean 311768.15
Minimum 277171.09
Maximum 344001.92
Spread ( max - min ) 66830.83
Range [ ( max - min ) / 2 * 100% ] 10.72%
Standard Deviation 10082.5245
5th Percentile 295369.81
95th Percentile 328315.79
( 95th Percentile - 5th Percentile ) 32945.99
Mean Distribution
Standard Deviation 201.6908
95.00% Confidence Intervall ( 311372.84 - 312163.45 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4017
0.1 Scale Factor Error with Delta=300 867805
0.05 Scale Factor Error with Delta=300 3471220
0.01 Scale Factor Error with Delta=300 86780518
Priority Target DPS
Sample Data bloodthirsty_instinct_865 Priority Target Damage Per Second
Count 2499
Mean 311768.15
Minimum 277171.09
Maximum 344001.92
Spread ( max - min ) 66830.83
Range [ ( max - min ) / 2 * 100% ] 10.72%
Standard Deviation 10082.5245
5th Percentile 295369.81
95th Percentile 328315.79
( 95th Percentile - 5th Percentile ) 32945.99
Mean Distribution
Standard Deviation 201.6908
95.00% Confidence Intervall ( 311372.84 - 312163.45 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4017
0.1 Scale Factor Error with Delta=300 867805
0.05 Scale Factor Error with Delta=300 3471220
0.01 Scale Factor Error with Delta=300 86780518
DPS(e)
Sample Data bloodthirsty_instinct_865 Damage Per Second (Effective)
Count 2499
Mean 311768.15
Minimum 277171.09
Maximum 344001.92
Spread ( max - min ) 66830.83
Range [ ( max - min ) / 2 * 100% ] 10.72%
Damage
Sample Data bloodthirsty_instinct_865 Damage
Count 2499
Mean 140215505.58
Minimum 101679442.33
Maximum 176690685.45
Spread ( max - min ) 75011243.12
Range [ ( max - min ) / 2 * 100% ] 26.75%
DTPS
Sample Data bloodthirsty_instinct_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data bloodthirsty_instinct_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data bloodthirsty_instinct_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data bloodthirsty_instinct_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data bloodthirsty_instinct_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data bloodthirsty_instinct_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data bloodthirsty_instinct_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data bloodthirsty_instinct_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.57 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.57 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.22 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 3.91 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 49.42 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.17 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.86 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 10.41 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 6.80 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.11 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.57 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.69 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.63 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 110.77 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQCAQQIQEMJQOPQELOQQQEJQQQQPEKOQQQCQEJN89QQPEKQQOPEJOQCQEJOPQQEKOQQEJMPQEKOQCQQEJOPQQEJOPQQEICOPQEJOQQQEJOPQEIOCQPEJN89QQELMQQEKPOQEJOQPQCAEJOQQEKQQQQELOPQEJOQQEKOPCQQQEJOQQEJOPQQQEKMOCPEJOQQQQEKOPOQEJQPCQEJN89QQQQEKOPOEJQPCQQQEJOQQEIMOPEJOQCQPEJOQQQEIOPDQEOQQCABPKQQQQEDOQQQELOPQQEKOPCODQQQELMOPEKOQQPECDN89QQQEKPQQOEDOQ

Sample Sequence Table

time name target resources buffs
Pre flask bloodthirsty_instinct_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food bloodthirsty_instinct_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation bloodthirsty_instinct_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, blood_frenzy, potion_of_the_old_war
0:01.004 lunar_inspiration Fluffy_Pillow 77.7/100: 78% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, blood_frenzy, potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 63.5/100: 63% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, blood_frenzy, potion_of_the_old_war
0:03.015 tigers_fury Fluffy_Pillow 39.2/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, blood_frenzy, potion_of_the_old_war
0:03.015 berserk Fluffy_Pillow 99.2/100: 99% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, tigers_fury, blood_frenzy, potion_of_the_old_war
0:03.015 shred Fluffy_Pillow 99.2/150: 66% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, blood_frenzy, potion_of_the_old_war
0:04.018 shred Fluffy_Pillow 109.9/150: 73% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, blood_frenzy, potion_of_the_old_war
0:05.024 savage_roar Fluffy_Pillow 120.6/150: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, blood_frenzy, potion_of_the_old_war
0:06.028 shred Fluffy_Pillow 131.4/150: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:07.034 healing_touch Fluffy_Pillow 147.1/150: 98% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:07.788 ashamanes_frenzy Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:08.791 rip Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:09.795 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:10.798 rake Fluffy_Pillow 145.7/150: 97% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
0:11.803 lunar_inspiration Fluffy_Pillow 143.9/150: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:12.807 shred Fluffy_Pillow 144.6/150: 96% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:13.812 healing_touch Fluffy_Pillow 140.4/150: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
0:14.566 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, blood_frenzy, potion_of_the_old_war
0:15.572 rake Fluffy_Pillow 139.2/150: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.576 shred Fluffy_Pillow 135.7/150: 90% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.580 shred Fluffy_Pillow 129.7/150: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.584 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:19.588 healing_touch Fluffy_Pillow 74.0/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.342 rip Fluffy_Pillow 84.5/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, potion_of_the_old_war
0:21.348 shred Fluffy_Pillow 98.4/100: 98% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.352 shred Fluffy_Pillow 72.4/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.355 shred Fluffy_Pillow 86.4/100: 86% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.360 shred Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:25.367 lunar_inspiration Fluffy_Pillow 74.4/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:26.372 healing_touch Fluffy_Pillow 58.3/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:27.127 savage_roar Fluffy_Pillow 68.8/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar
0:28.131 rake Fluffy_Pillow 82.8/100: 83% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:29.136 shred Fluffy_Pillow 61.8/100: 62% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:30.141 shred Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:31.145 shred Fluffy_Pillow 49.7/100: 50% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:32.148 Waiting 0.700 sec 23.7/100: 24% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:32.848 tigers_fury Fluffy_Pillow 33.4/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:33.015 shred Fluffy_Pillow 95.7/100: 96% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.021 healing_touch Fluffy_Pillow 84.7/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.776 rip Fluffy_Pillow 95.2/100: 95% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:35.780 shadowmeld Fluffy_Pillow 94.2/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.780 rake Fluffy_Pillow 94.2/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.780 auto_attack Fluffy_Pillow 59.2/100: 59% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.785 shred Fluffy_Pillow 88.2/100: 88% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:37.788 shred Fluffy_Pillow 62.1/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:38.794 Waiting 0.100 sec 37.9/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:38.894 lunar_inspiration Fluffy_Pillow 39.5/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:39.898 healing_touch Fluffy_Pillow 25.2/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
0:40.653 Waiting 4.200 sec 37.0/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
0:44.853 savage_roar Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
0:45.857 shred Fluffy_Pillow 60.7/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
0:46.861 Waiting 0.600 sec 32.8/100: 33% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:47.461 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
0:48.465 Waiting 1.287 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:50.773 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:51.776 Waiting 1.647 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:53.423 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
0:54.428 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
0:55.262 Waiting 0.689 sec 22.7/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
0:55.951 rip Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
0:59.000 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:00.005 Waiting 2.144 sec 14.8/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:02.149 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
1:03.153 tigers_fury Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
1:03.153 shred Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:04.156 healing_touch Fluffy_Pillow 97.5/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:05.095 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
1:06.099 rake Fluffy_Pillow 95.7/100: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:07.104 lunar_inspiration Fluffy_Pillow 86.5/100: 86% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:08.109 shred Fluffy_Pillow 67.3/100: 67% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:09.114 Waiting 0.200 sec 38.0/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:09.314 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:10.320 healing_touch Fluffy_Pillow 10.9/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:11.259 Waiting 3.177 sec 21.0/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:14.436 savage_roar Fluffy_Pillow 55.0/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
1:15.440 rake Fluffy_Pillow 65.7/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
1:16.444 shred Fluffy_Pillow 41.4/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:17.448 shred Fluffy_Pillow 52.2/100: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:18.452 healing_touch Fluffy_Pillow 22.9/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:19.390 Waiting 5.300 sec 33.0/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:24.690 rip Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:25.695 ashamanes_frenzy Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:26.699 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:27.704 shred Fluffy_Pillow 80.8/100: 81% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:28.709 healing_touch Fluffy_Pillow 51.5/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:29.649 savage_roar Fluffy_Pillow 61.6/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:30.909 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:31.915 shred Fluffy_Pillow 10.8/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
1:32.920 tigers_fury Fluffy_Pillow 21.6/100: 22% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:33.153 shred Fluffy_Pillow 84.1/100: 84% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:34.157 shred Fluffy_Pillow 69.8/100: 70% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.163 healing_touch Fluffy_Pillow 55.6/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:36.101 Waiting 0.900 sec 65.6/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:37.001 rip Fluffy_Pillow 90.2/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:38.004 rake Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:39.007 lunar_inspiration Fluffy_Pillow 48.2/100: 48% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:40.012 Waiting 0.900 sec 30.3/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:40.912 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
1:41.915 Waiting 2.279 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:44.194 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:45.199 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:46.033 Waiting 3.883 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:49.916 rip Fluffy_Pillow 69.5/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
1:50.920 rake Fluffy_Pillow 51.6/100: 52% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
1:51.924 Waiting 0.200 sec 28.7/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:52.124 lunar_inspiration Fluffy_Pillow 31.1/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:53.128 Waiting 2.278 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
1:55.406 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:56.413 Waiting 2.774 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:59.187 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:00.192 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:02.919 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
2:03.923 tigers_fury Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:03.923 rake Fluffy_Pillow 71.7/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:04.929 lunar_inspiration Fluffy_Pillow 62.5/100: 62% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:05.935 shred Fluffy_Pillow 58.2/100: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:06.941 healing_touch Fluffy_Pillow 44.0/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
2:07.878 Waiting 3.000 sec 54.0/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:10.878 rip Fluffy_Pillow 87.0/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
2:11.881 rake Fluffy_Pillow 69.0/100: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:12.884 shred Fluffy_Pillow 46.1/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:13.888 Waiting 0.563 sec 18.2/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:14.451 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
2:15.455 Waiting 0.300 sec 37.1/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:15.755 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:16.758 healing_touch Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:17.592 Waiting 4.982 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
2:22.574 rip Fluffy_Pillow 79.7/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:23.579 rake Fluffy_Pillow 60.4/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:24.584 lunar_inspiration Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:25.590 Waiting 1.855 sec 18.3/100: 18% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:27.445 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, blood_frenzy
2:28.451 healing_touch Fluffy_Pillow 12.8/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, blood_frenzy
2:30.818 savage_roar Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), blood_frenzy
2:31.823 rake Fluffy_Pillow 13.4/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
2:32.827 Waiting 0.900 sec 25.4/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:33.727 tigers_fury Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:33.923 shred Fluffy_Pillow 98.6/100: 99% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:34.930 lunar_inspiration Fluffy_Pillow 85.4/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:35.934 healing_touch Fluffy_Pillow 82.5/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:36.768 rip Fluffy_Pillow 92.6/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
2:37.773 shadowmeld Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:37.773 rake Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:37.773 auto_attack Fluffy_Pillow 54.7/100: 55% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:38.779 shred Fluffy_Pillow 66.8/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:39.784 shred Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:40.788 healing_touch Fluffy_Pillow 51.0/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
2:41.624 Waiting 2.300 sec 61.0/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
2:43.924 ferocious_bite Fluffy_Pillow 88.7/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
2:44.929 ashamanes_frenzy Fluffy_Pillow 50.8/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
2:45.932 shred Fluffy_Pillow 62.9/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
2:46.935 Waiting 0.500 sec 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:47.435 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:48.439 healing_touch Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
2:49.355 Waiting 0.177 sec 23.1/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:49.532 savage_roar Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
2:50.535 lunar_inspiration Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
2:53.327 rake Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
2:54.330 shred Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:55.335 healing_touch Fluffy_Pillow 57.1/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:56.273 Waiting 1.400 sec 67.1/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:57.673 rip Fluffy_Pillow 82.1/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:58.677 rake Fluffy_Pillow 62.8/100: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:59.681 Waiting 0.200 sec 38.6/100: 39% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:59.881 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:00.885 Waiting 1.764 sec 11.5/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:02.649 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
3:03.654 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:04.660 tigers_fury Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:04.660 berserk Fluffy_Pillow 71.9/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:04.660 healing_touch Fluffy_Pillow 71.9/150: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:05.599 rip Fluffy_Pillow 81.9/150: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury
3:06.603 rake Fluffy_Pillow 92.7/150: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:07.608 shred Fluffy_Pillow 100.9/150: 67% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:08.613 shred Fluffy_Pillow 106.7/150: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:09.617 healing_touch Fluffy_Pillow 97.4/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:10.556 savage_roar Fluffy_Pillow 107.5/150: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury
3:11.561 shred Fluffy_Pillow 98.2/150: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury
3:12.565 shred Fluffy_Pillow 89.8/150: 60% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:13.571 shred Fluffy_Pillow 82.0/150: 55% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy
3:14.576 shred Fluffy_Pillow 74.1/150: 49% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy
3:15.580 healing_touch Fluffy_Pillow 66.1/150: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy
3:16.414 ferocious_bite Fluffy_Pillow 76.2/150: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, blood_frenzy
3:17.420 rake Fluffy_Pillow 63.3/150: 42% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, blood_frenzy
3:18.425 lunar_inspiration Fluffy_Pillow 57.9/150: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy
3:19.428 shred Fluffy_Pillow 55.0/150: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, blood_frenzy
3:20.434 healing_touch Fluffy_Pillow 67.1/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:21.267 Waiting 1.100 sec 77.1/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
3:22.367 rip Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:23.369 rake Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
3:24.375 shred Fluffy_Pillow 48.3/100: 48% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:25.377 Waiting 1.681 sec 20.4/100: 20% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:27.058 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:28.063 healing_touch Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:28.898 Waiting 2.382 sec 22.8/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
3:31.280 savage_roar Fluffy_Pillow 51.5/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
3:32.284 rake Fluffy_Pillow 63.6/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
3:33.289 lunar_inspiration Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:34.293 Waiting 0.397 sec 20.7/100: 21% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:34.690 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:34.690 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:35.694 shred Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:36.699 shred Fluffy_Pillow 56.5/100: 56% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:37.706 healing_touch Fluffy_Pillow 42.3/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
3:38.612 Waiting 1.100 sec 52.3/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
3:39.712 rip Fluffy_Pillow 65.6/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, blood_frenzy
3:40.716 rake Fluffy_Pillow 77.6/100: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:41.721 shred Fluffy_Pillow 54.7/100: 55% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
3:42.725 Waiting 1.100 sec 26.8/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:43.825 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:44.831 healing_touch Fluffy_Pillow 12.2/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:45.664 Waiting 5.031 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
3:50.695 rip Fluffy_Pillow 81.6/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
3:51.700 rake Fluffy_Pillow 93.7/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
3:52.703 lunar_inspiration Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:53.709 shred Fluffy_Pillow 52.9/100: 53% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:54.713 Waiting 1.300 sec 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:56.013 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:57.017 shred Fluffy_Pillow 12.7/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
3:58.022 healing_touch Fluffy_Pillow 24.8/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
3:58.856 Waiting 2.900 sec 34.9/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
4:01.756 savage_roar Fluffy_Pillow 66.4/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:02.760 ashamanes_frenzy Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:03.765 rake Fluffy_Pillow 47.9/100: 48% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
4:04.771 tigers_fury Fluffy_Pillow 23.7/100: 24% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:04.771 lunar_inspiration Fluffy_Pillow 83.7/100: 84% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:05.777 healing_touch Fluffy_Pillow 79.4/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:06.716 rip Fluffy_Pillow 89.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:07.720 rake Fluffy_Pillow 85.2/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:08.726 shred Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
4:09.730 shred Fluffy_Pillow 46.7/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
4:10.735 Waiting 0.702 sec 17.5/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:11.437 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
4:12.442 Waiting 0.400 sec 35.8/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:12.842 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:13.849 healing_touch Fluffy_Pillow 10.8/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:14.789 Waiting 4.586 sec 20.9/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:19.375 savage_roar Fluffy_Pillow 69.9/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:20.380 rake Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:21.384 Waiting 1.300 sec 16.4/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:22.684 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:23.688 Waiting 1.299 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:26.011 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:27.015 Waiting 1.243 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:28.258 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
4:29.261 healing_touch Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:30.178 rip Fluffy_Pillow 45.8/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy, jacins_ruse
4:31.182 Waiting 0.500 sec 27.8/100: 28% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:31.682 shred Fluffy_Pillow 33.9/100: 34% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:32.687 lunar_inspiration Fluffy_Pillow 46.0/100: 46% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:33.691 Waiting 0.900 sec 28.1/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:34.591 tigers_fury Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
4:34.771 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
4:35.774 healing_touch Fluffy_Pillow 87.1/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:36.607 rip Fluffy_Pillow 97.1/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
4:37.611 shadowmeld Fluffy_Pillow 94.2/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:37.773 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:37.773 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:38.777 shred Fluffy_Pillow 77.1/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:39.783 shred Fluffy_Pillow 49.2/100: 49% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
4:40.787 Waiting 1.443 sec 20.3/100: 20% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:42.230 shred Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
4:43.235 shred Fluffy_Pillow 46.5/100: 46% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:44.239 healing_touch Fluffy_Pillow 17.2/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:45.178 Waiting 2.500 sec 27.2/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:47.678 savage_roar Fluffy_Pillow 54.0/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:48.684 Waiting 0.500 sec 24.8/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:49.697 rake Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:50.698 Waiting 1.779 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:52.477 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:55.785 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
4:56.790 healing_touch Fluffy_Pillow 11.5/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
4:57.660 rip Fluffy_Pillow 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
4:58.665 Waiting 0.600 sec 33.7/100: 34% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
4:59.265 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:00.271 Waiting 2.097 sec 13.0/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:02.368 lunar_inspiration Fluffy_Pillow 38.2/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
5:03.373 Waiting 1.187 sec 20.3/100: 20% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
5:04.560 tigers_fury Fluffy_Pillow 34.6/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
5:04.771 shred Fluffy_Pillow 97.2/100: 97% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:05.775 shred Fluffy_Pillow 84.3/100: 84% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:06.781 shred Fluffy_Pillow 71.4/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:07.785 healing_touch Fluffy_Pillow 57.5/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:08.724 rip Fluffy_Pillow 67.6/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
5:09.728 rake Fluffy_Pillow 48.3/100: 48% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:10.734 Waiting 1.500 sec 24.1/100: 24% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:12.234 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:13.239 Waiting 2.816 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:16.055 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, jacins_ruse
5:17.059 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, jacins_ruse
5:19.783 savage_roar Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
5:20.787 ashamanes_frenzy Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:23.069 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:24.073 Waiting 1.730 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:25.803 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:26.808 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:27.748 Waiting 1.958 sec 21.2/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:29.706 rip Fluffy_Pillow 42.1/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
5:30.711 rake Fluffy_Pillow 52.9/100: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:31.715 Waiting 1.100 sec 28.6/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:32.815 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
5:33.817 Waiting 0.982 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
5:34.799 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, blood_frenzy, jacins_ruse
5:34.799 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:35.803 lunar_inspiration Fluffy_Pillow 72.1/100: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:36.809 healing_touch Fluffy_Pillow 69.2/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:37.644 Waiting 0.200 sec 79.2/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:37.844 rip Fluffy_Pillow 96.7/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, blood_frenzy, jacins_ruse
5:38.848 rake Fluffy_Pillow 78.7/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:39.851 shred Fluffy_Pillow 55.8/100: 56% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:40.854 Waiting 1.100 sec 27.9/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:41.954 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
5:42.958 Waiting 2.685 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:45.643 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
5:46.646 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
5:49.368 savage_roar Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
5:52.669 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, blood_frenzy
5:53.674 Waiting 1.347 sec 14.8/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:55.021 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:57.052 ferocious_bite Fluffy_Pillow 25.5/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, blood_frenzy
5:58.056 shred Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
5:59.059 Waiting 0.900 sec 24.2/100: 24% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, blood_frenzy
5:59.959 healing_touch Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, blood_frenzy
6:00.793 rake Fluffy_Pillow 45.0/100: 45% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons(2), savage_roar, blood_frenzy
6:01.796 shred Fluffy_Pillow 56.8/100: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, savage_roar
6:02.801 Waiting 1.200 sec 27.6/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points savage_roar
6:04.001 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points savage_roar
6:05.005 tigers_fury Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points savage_roar
6:05.005 berserk Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, savage_roar, tigers_fury
6:05.005 potion Fluffy_Pillow 71.2/150: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, savage_roar, tigers_fury
6:05.005 lunar_inspiration Fluffy_Pillow 71.2/150: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:06.009 savage_roar Fluffy_Pillow 81.9/150: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:07.013 shred Fluffy_Pillow 87.6/150: 58% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:08.016 shred Fluffy_Pillow 93.4/150: 62% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:09.020 shred Fluffy_Pillow 85.5/150: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:10.024 shred Fluffy_Pillow 77.5/150: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:11.027 healing_touch Fluffy_Pillow 69.6/150: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:11.861 ferocious_bite Fluffy_Pillow 79.7/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:12.866 rake Fluffy_Pillow 79.3/150: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy, potion_of_the_old_war
6:13.869 shred Fluffy_Pillow 73.8/150: 49% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:14.873 shred Fluffy_Pillow 85.9/150: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:15.877 shred Fluffy_Pillow 78.0/150: 52% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:16.881 healing_touch Fluffy_Pillow 70.1/150: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, blood_frenzy, potion_of_the_old_war
6:17.717 ferocious_bite Fluffy_Pillow 80.2/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, blood_frenzy, potion_of_the_old_war
6:18.722 rake Fluffy_Pillow 66.3/150: 44% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:19.727 lunar_inspiration Fluffy_Pillow 59.6/150: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:20.729 shred Fluffy_Pillow 55.3/100: 55% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:21.734 Waiting 1.400 sec 26.1/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:23.134 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:24.139 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:25.078 Waiting 5.295 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:30.373 savage_roar Fluffy_Pillow 78.5/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:31.379 rake Fluffy_Pillow 49.3/100: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:32.382 Waiting 0.500 sec 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
6:32.882 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
6:33.887 Waiting 1.298 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar
6:35.185 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar
6:35.185 rake Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:36.189 ferocious_bite Fluffy_Pillow 75.7/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:37.192 shred Fluffy_Pillow 51.5/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:38.196 Waiting 0.300 sec 37.2/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
6:38.496 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
6:39.500 shred Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
6:40.505 healing_touch Fluffy_Pillow 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
6:41.444 Waiting 5.400 sec 32.0/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
6:46.844 ferocious_bite Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:47.848 ashamanes_frenzy Fluffy_Pillow 50.5/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:48.854 rake Fluffy_Pillow 61.3/100: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
6:49.860 lunar_inspiration Fluffy_Pillow 72.0/100: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:50.865 healing_touch Fluffy_Pillow 52.8/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:51.804 Waiting 2.500 sec 62.8/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:54.304 savage_roar Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:55.309 rake Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
6:56.312 Waiting 0.400 sec 36.1/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:56.712 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:57.717 Waiting 2.799 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:00.516 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:01.522 Waiting 1.534 sec 12.5/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:03.056 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:04.061 healing_touch Fluffy_Pillow 13.1/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, blood_frenzy
7:04.897 Waiting 0.151 sec 23.2/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
7:05.048 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, blood_frenzy
7:05.185 ferocious_bite Fluffy_Pillow 86.6/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, blood_frenzy
7:06.190 shadowmeld Fluffy_Pillow 63.7/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:06.190 rake Fluffy_Pillow 63.7/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:06.190 auto_attack Fluffy_Pillow 28.7/100: 29% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:07.195 shred Fluffy_Pillow 55.8/100: 56% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:08.199 shred Fluffy_Pillow 42.9/100: 43% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:09.204 Waiting 0.827 sec 15.0/100: 15% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:10.031 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, blood_frenzy
7:11.035 healing_touch Fluffy_Pillow 37.0/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
7:11.973 Waiting 2.800 sec 47.0/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
7:14.773 savage_roar Fluffy_Pillow 77.0/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
7:15.777 lunar_inspiration Fluffy_Pillow 87.7/100: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:16.783 shred Fluffy_Pillow 68.5/100: 69% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:17.789 Waiting 0.100 sec 39.3/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
7:17.889 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
7:18.894 rake Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
7:19.900 healing_touch Fluffy_Pillow 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:20.839 ferocious_bite Fluffy_Pillow 31.9/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:21.843 Waiting 1.332 sec 10.7/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:24.196 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:25.200 Waiting 2.746 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:27.946 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:28.951 Waiting 1.233 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 23138 21431 11378 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 27766 25717 0
Crit 33.77% 33.77% 6220
Haste 7.01% 7.01% 2277
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 23138 21431 0
Mastery 51.70% 49.54% 5871
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 846.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Bloodthirsty Instinct
ilevel: 865, stats: { +1418 Agi }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="bloodthirsty_instinct_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=bloodthirsty_instinct,id=139329,bonus_id=1805,ilevel=865
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=845.67
# gear_agility=11378
# gear_stamina=17628
# gear_crit_rating=6220
# gear_haste_rating=1518
# gear_mastery_rating=5871
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

natures_call_865 : 298185 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
298185.1 298185.1 386.1 / 0.129% 39174.0 / 13.1% 20276.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.7 14.7 Energy 30.87% 42.8 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
natures_call_865 298185
Ashamane's Frenzy 14385 4.8% 6.1 78.45sec 1060324 1055660 Direct 91.3 9725 19468 13186 35.5%  
Periodic 30.2 128661 257508 174493 35.6% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.10 91.28 121.46 30.18 1.0045 0.6473 6470141.98 7035969.52 8.04 76344.76 1055660.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.86 64.48% 9725.22 7168 12497 9726.49 8589 10635 572431 841527 31.98
crit 32.42 35.52% 19468.07 14337 24995 19471.78 17355 21796 631215 927946 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.4 64.43% 128660.78 79037 172240 128698.12 115103 144825 2501918 2501918 0.00
crit 10.7 35.57% 257507.86 158074 344480 257509.48 209532 296757 2764578 2764578 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 35240 11.8% 18.3 22.96sec 864564 0 Periodic 144.0 81305 162537 110122 35.5% 41.2%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.34 0.00 143.97 143.97 0.0000 1.2886 15854832.59 15854832.59 0.00 85456.98 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.9 64.52% 81305.37 56 104331 81223.23 72849 89403 7553073 7553073 0.00
crit 51.1 35.48% 162537.29 112 208661 162349.27 140822 179319 8301760 8301760 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 27732 9.3% 505.6 0.89sec 24673 27795 Direct 505.6 18231 36468 24673 35.3%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 505.62 505.62 0.00 0.00 0.8877 0.0000 12475245.20 18339792.14 31.98 27795.41 27795.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 327.02 64.68% 18231.12 14216 20436 18230.91 17879 18556 5961978 8764673 31.98
crit 178.60 35.32% 36468.39 28433 40872 36468.70 35462 37294 6513267 9575119 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6316 2.1% 10.5 45.05sec 270161 268956 Direct 10.5 188812 417964 270140 35.5%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.49 10.49 0.00 0.00 1.0045 0.0000 2834796.03 4167418.68 31.98 268955.98 268955.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.77 64.50% 188812.23 14681 251221 188625.64 29127 251221 1277773 1878448 31.98
crit 3.73 35.50% 417964.50 33465 555198 412555.62 0 555198 1557023 2288971 31.64
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 22214 7.5% 31.6 14.35sec 316613 315199 Direct 31.6 32994 66027 44770 35.6%  
Periodic 249.6 25381 50769 34373 35.4% 96.7%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.56 31.56 249.61 249.61 1.0045 1.7441 9992767.85 9992767.85 0.00 21395.27 315199.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.31 64.36% 32993.73 25727 36982 32990.08 30916 34685 670166 670166 0.00
crit 11.25 35.64% 66027.17 51454 73964 66010.26 57885 71553 742792 742792 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 161.2 64.58% 25380.86 43 28764 25381.33 24351 26029 4091328 4091328 0.00
crit 88.4 35.42% 50769.13 87 57529 50769.23 47758 52469 4488482 4488482 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2178 0.7% 24.1 18.39sec 40749 0 Periodic 71.1 13778 0 13778 0.0% 7.9%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.05 0.00 71.14 71.14 0.0000 0.4972 980186.90 1440967.59 31.98 27714.73 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.1 100.00% 13778.43 27 15493 13781.64 12814 14716 980187 1440968 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11275 3.7% 23.6 17.19sec 212091 0 Direct 23.6 156481 313235 212094 35.5%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.59 23.59 0.00 0.00 0.0000 0.0000 5003615.90 7355789.33 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.22 64.52% 156480.97 122075 175482 156437.90 139877 167308 2382001 3501767 31.98
crit 8.37 35.48% 313235.19 244149 350964 313233.92 259408 350964 2621615 3854023 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 68222 22.9% 47.2 9.58sec 650876 647966 Direct 47.2 83285 166627 112662 35.2%  
Periodic 223.5 83742 167890 113548 35.4% 94.8%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.15 47.15 223.51 223.51 1.0045 1.9078 30690924.30 30690924.30 0.00 64782.00 647966.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.54 64.76% 83284.63 38757 202706 83291.55 72293 96033 2543320 2543320 0.00
crit 16.62 35.24% 166626.93 77514 405411 166595.63 134462 226258 2768533 2768533 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 144.3 64.58% 83742.13 36 202706 83766.07 74556 92366 12086564 12086564 0.00
crit 79.2 35.42% 167889.74 101 405411 167891.88 137631 195380 13292508 13292508 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 81874 27.5% 22.8 15.68sec 1616169 1608994 Periodic 326.0 83531 167005 113030 35.3% 95.9%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.80 0.00 326.04 326.04 1.0045 1.3241 36852394.79 36852394.79 0.00 81060.01 1608993.83
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 210.8 64.66% 83530.64 64 104331 83521.24 78119 87068 17610622 17610622 0.00
crit 115.2 35.34% 167005.48 124 208661 166993.19 152570 175269 19241773 19241773 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 28747 9.6% 107.7 4.17sec 119978 119441 Direct 107.7 88629 177226 119978 35.4%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.67 107.67 0.00 0.00 1.0045 0.0000 12918547.95 18991489.16 31.98 119441.45 119441.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.57 64.61% 88629.18 61977 133637 88651.47 82619 94552 6166172 9064857 31.98
crit 38.10 35.39% 177226.05 123954 267275 177162.34 161346 198761 6752376 9926632 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
natures_call_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:natures_call_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 181.89sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Cleansed Drake's Breath 4.3 77.87sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:natures_call_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:natures_call_865
  • harmful:false
  • if_expr:
 
Healing Touch 50.1 9.11sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.06 0.00 0.00 0.00 0.8798 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.6 24.76sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.56 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.58sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.32sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.18% 45.4(45.4) 15.1

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 15.05% 0.0(0.0) 2.9

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.03% 0.0(0.0) 1.0

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 50.0 0.0 9.1sec 9.1sec 46.15% 46.19% 0.0(0.0) 0.0

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:19.00%
  • bloodtalons_2:27.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Cleansed Ancient's Blessing 3.9 0.3 88.2sec 79.3sec 9.03% 9.12% 0.3(0.3) 3.8

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_ancients_blessing_1:9.03%

Trigger Attempt Success

  • trigger_pct:99.02%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 3.9 0.4 88.1sec 78.3sec 9.10% 9.19% 0.4(0.4) 3.9

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_sisters_blessing_1:9.10%

Trigger Attempt Success

  • trigger_pct:98.39%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 4.0 0.3 87.1sec 78.9sec 9.15% 9.25% 0.3(0.3) 3.9

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2720.70

Stack Uptimes

  • cleansed_wisps_blessing_1:9.15%

Trigger Attempt Success

  • trigger_pct:98.95%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Clearcasting 43.1 1.3 10.3sec 10.0sec 6.32% 15.20% 1.3(1.3) 0.0

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.32%

Trigger Attempt Success

  • trigger_pct:8.78%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.7 1.8 64.3sec 48.9sec 24.65% 24.73% 1.8(1.8) 6.4

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.5sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 49.8 1.2 9.0sec 8.8sec 74.23% 74.24% 1.2(1.2) 0.0

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.23%

Trigger Attempt Success

  • trigger_pct:98.35%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.3 10.3 47.4sec 24.7sec 93.29% 92.99% 201.8(201.8) 7.3

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.6sec 133.6sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.82% 29.25% 0.0(0.0) 14.9

Buff details

  • buff initial source:natures_call_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
natures_call_865
ferocious_bite Energy 21.0 354.0 16.9 33.7 8008.4
ferocious_bite Combo Points 10.5 48.2 4.6 4.6 58812.9
lunar_inspiration Energy 31.6 780.8 24.7 24.7 12798.3
rake Energy 47.2 1341.7 28.5 28.5 22874.7
rip Energy 22.8 466.6 20.5 20.5 78981.6
rip Combo Points 22.8 114.0 5.0 5.0 323224.7
savage_roar Energy 18.6 476.8 25.7 25.7 0.0
savage_roar Combo Points 18.6 92.8 5.0 5.0 0.0
shred Energy 107.7 3192.3 29.6 29.6 4046.7
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.16 47.16 (18.26%) 1.00 0.00 0.00%
tigers_fury Energy 15.21 912.46 (11.35%) 59.98 0.37 0.04%
ashamanes_frenzy Combo Points 6.10 18.31 (7.09%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.56 31.56 (12.22%) 1.00 0.00 0.00%
shred Combo Points 107.67 107.67 (41.70%) 1.00 0.00 0.00%
energy_regen Energy 1976.34 4998.19 (62.16%) 2.53 65.61 1.30%
clearcasting Energy 42.99 1468.08 (18.26%) 34.15 0.00 0.00%
ashamanes_energy Energy 45.44 662.53 (8.24%) 14.58 19.04 2.79%
primal_fury Combo Points 65.97 53.50 (20.72%) 0.81 12.47 18.90%
Resource RPS-Gain RPS-Loss
Energy 14.61 14.69
Combo Points 0.57 0.57
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 35.31 0.08 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.19 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
clearcasting 44.4 10.0sec
clearcasting_wasted 1.3 118.3sec
primal_fury 66.0 6.8sec

Statistics & Data Analysis

Fight Length
Sample Data natures_call_865 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data natures_call_865 Damage Per Second
Count 2499
Mean 298185.09
Minimum 264394.93
Maximum 335537.20
Spread ( max - min ) 71142.26
Range [ ( max - min ) / 2 * 100% ] 11.93%
Standard Deviation 9848.8354
5th Percentile 282405.60
95th Percentile 314762.93
( 95th Percentile - 5th Percentile ) 32357.34
Mean Distribution
Standard Deviation 197.0161
95.00% Confidence Intervall ( 297798.95 - 298571.23 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4190
0.1 Scale Factor Error with Delta=300 828044
0.05 Scale Factor Error with Delta=300 3312176
0.01 Scale Factor Error with Delta=300 82804402
Priority Target DPS
Sample Data natures_call_865 Priority Target Damage Per Second
Count 2499
Mean 298185.09
Minimum 264394.93
Maximum 335537.20
Spread ( max - min ) 71142.26
Range [ ( max - min ) / 2 * 100% ] 11.93%
Standard Deviation 9848.8354
5th Percentile 282405.60
95th Percentile 314762.93
( 95th Percentile - 5th Percentile ) 32357.34
Mean Distribution
Standard Deviation 197.0161
95.00% Confidence Intervall ( 297798.95 - 298571.23 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4190
0.1 Scale Factor Error with Delta=300 828044
0.05 Scale Factor Error with Delta=300 3312176
0.01 Scale Factor Error with Delta=300 82804402
DPS(e)
Sample Data natures_call_865 Damage Per Second (Effective)
Count 2499
Mean 298185.09
Minimum 264394.93
Maximum 335537.20
Spread ( max - min ) 71142.26
Range [ ( max - min ) / 2 * 100% ] 11.93%
Damage
Sample Data natures_call_865 Damage
Count 2499
Mean 134073453.49
Minimum 102156811.09
Maximum 168580853.59
Spread ( max - min ) 66424042.50
Range [ ( max - min ) / 2 * 100% ] 24.77%
DTPS
Sample Data natures_call_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data natures_call_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data natures_call_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data natures_call_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data natures_call_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data natures_call_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data natures_call_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data natures_call_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.57 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.57 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.22 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 4.02 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 49.06 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.31 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.80 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 10.25 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 6.47 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.10 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.57 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.58 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.56 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 107.67 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQCAQIQQEMJQOPQELOQQEJQQQEKOPQELOCQQQQEJN89PQQEIPOOEJCQQQQEJOPQQEOIMPQEJCOQQEJOPQQEIOQPEOJQCQQPEJOQQQEIOPOEQJCQPQQEJMOQEIOQPQEJOQPQCAQEJN89QQQEIQQQPELOQQQEJOPQCQEIOQQPQEJOQQEJMOPEIOCQQQEJQPQQEKOQQPEOJQCQQQEJOPQEKOQQEJOPQQQECJN89PQQEIQMQEJOQPEKOQQCPDQQOQQEKODPQOCABEQJPQQQEKOQQQELOPQQELMQELCOPQEKOQQQEDOPQQEOCKN89DPQQEPKO

Sample Sequence Table

time name target resources buffs
Pre flask natures_call_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food natures_call_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation natures_call_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, potion_of_the_old_war
0:01.007 lunar_inspiration Fluffy_Pillow 76.2/100: 76% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.013 shred Fluffy_Pillow 60.4/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:03.018 tigers_fury Fluffy_Pillow 34.6/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, potion_of_the_old_war
0:03.018 berserk Fluffy_Pillow 94.6/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:03.018 shred Fluffy_Pillow 94.6/150: 63% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:04.024 savage_roar Fluffy_Pillow 103.8/150: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:05.030 shred Fluffy_Pillow 113.0/150: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:06.036 shred Fluffy_Pillow 122.2/150: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:07.040 healing_touch Fluffy_Pillow 116.3/150: 78% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:07.795 ashamanes_frenzy Fluffy_Pillow 127.0/150: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:08.800 rip Fluffy_Pillow 141.2/150: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:09.805 shred Fluffy_Pillow 140.3/150: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:10.810 rake Fluffy_Pillow 134.5/150: 90% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
0:11.815 lunar_inspiration Fluffy_Pillow 131.2/150: 87% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:12.820 shred Fluffy_Pillow 130.4/150: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:13.823 healing_touch Fluffy_Pillow 124.5/150: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:14.577 ferocious_bite Fluffy_Pillow 135.2/150: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
0:15.582 rake Fluffy_Pillow 124.3/150: 83% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:16.586 shred Fluffy_Pillow 121.0/150: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:17.593 shred Fluffy_Pillow 115.2/150: 77% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:18.598 healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:19.353 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, jacins_ruse, potion_of_the_old_war
0:20.357 shred Fluffy_Pillow 84.2/100: 84% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:21.361 shred Fluffy_Pillow 58.3/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
0:22.365 Waiting 0.500 sec 32.6/100: 33% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:22.865 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
0:23.870 healing_touch Fluffy_Pillow 16.3/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
0:24.626 Waiting 1.100 sec 28.2/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse
0:25.726 savage_roar Fluffy_Pillow 45.6/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse
0:26.731 rake Fluffy_Pillow 61.4/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
0:27.736 lunar_inspiration Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
0:28.741 shred Fluffy_Pillow 28.0/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
0:29.746 healing_touch Fluffy_Pillow 43.8/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
0:30.501 ferocious_bite Fluffy_Pillow 55.7/100: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse
0:31.506 Waiting 0.220 sec 21.5/100: 22% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
0:32.493 rake Fluffy_Pillow 36.7/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:33.500 tigers_fury Fluffy_Pillow 15.9/100: 16% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar
0:33.500 shred Fluffy_Pillow 75.9/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.505 shred Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.510 shred Fluffy_Pillow 54.3/100: 54% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.514 shred Fluffy_Pillow 83.4/100: 83% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:37.518 healing_touch Fluffy_Pillow 57.6/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:38.271 Waiting 1.300 sec 68.2/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:39.571 rip Fluffy_Pillow 86.6/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:40.575 shadowmeld Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:40.575 rake Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:40.575 auto_attack Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:41.580 lunar_inspiration Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:42.585 Waiting 1.200 sec 27.5/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:43.785 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:44.789 Waiting 2.647 sec 11.5/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:47.436 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
0:48.442 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
0:49.368 Waiting 2.753 sec 21.2/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing
0:52.121 savage_roar Fluffy_Pillow 51.0/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), cleansed_wisps_blessing, jacins_ruse
0:53.126 Waiting 0.281 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
0:53.407 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
0:54.414 rake Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
0:55.417 Waiting 2.115 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
0:57.786 rake Fluffy_Pillow 37.5/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:58.793 healing_touch Fluffy_Pillow 13.4/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:59.718 Waiting 0.639 sec 23.5/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:00.357 rip Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
1:01.362 Waiting 1.959 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:03.321 tigers_fury Fluffy_Pillow 32.6/100: 33% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
1:03.500 shred Fluffy_Pillow 94.5/100: 95% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:04.505 shred Fluffy_Pillow 80.4/100: 80% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:05.510 shred Fluffy_Pillow 66.3/100: 66% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
1:06.514 shred Fluffy_Pillow 52.2/100: 52% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:07.517 healing_touch Fluffy_Pillow 23.1/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:08.441 Waiting 1.000 sec 33.2/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:09.441 rip Fluffy_Pillow 44.0/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:10.959 rake Fluffy_Pillow 30.5/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:11.962 lunar_inspiration Fluffy_Pillow 41.4/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:12.967 Waiting 1.651 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:14.618 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:15.622 Waiting 2.682 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
1:18.304 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, jacins_ruse
1:19.309 Waiting 1.281 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, jacins_ruse
1:20.590 healing_touch Fluffy_Pillow 25.6/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, cleansed_sisters_blessing, jacins_ruse
1:21.419 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, bloodtalons(2), cleansed_sisters_blessing, jacins_ruse
1:22.425 savage_roar Fluffy_Pillow 47.9/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, cleansed_sisters_blessing, jacins_ruse
1:23.429 ashamanes_frenzy Fluffy_Pillow 20.0/100: 20% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
1:24.431 lunar_inspiration Fluffy_Pillow 32.2/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
1:25.435 Waiting 2.183 sec 14.3/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
1:27.618 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
1:28.622 healing_touch Fluffy_Pillow 12.9/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
1:29.452 Waiting 0.669 sec 22.9/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
1:30.121 rip Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:33.427 tigers_fury Fluffy_Pillow 36.9/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:33.500 rake Fluffy_Pillow 97.7/100: 98% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:34.504 shred Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.508 shred Fluffy_Pillow 74.5/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:36.514 healing_touch Fluffy_Pillow 60.4/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:37.440 Waiting 1.800 sec 70.4/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:39.240 rip Fluffy_Pillow 90.0/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:40.243 rake Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:41.246 lunar_inspiration Fluffy_Pillow 81.7/100: 82% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
1:42.252 shred Fluffy_Pillow 62.6/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
1:43.257 shred Fluffy_Pillow 73.6/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:44.261 healing_touch Fluffy_Pillow 44.4/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:45.188 Waiting 1.300 sec 54.5/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:46.488 savage_roar Fluffy_Pillow 68.6/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
1:47.493 rake Fluffy_Pillow 39.5/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:48.496 Waiting 2.283 sec 15.4/100: 15% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:50.779 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:51.783 Waiting 1.782 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:53.565 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:54.570 Waiting 2.459 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:57.029 healing_touch Fluffy_Pillow 38.0/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:57.954 rake Fluffy_Pillow 48.1/100: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
1:58.959 Waiting 0.200 sec 24.0/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar
1:59.159 rip Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar
2:00.163 Waiting 0.300 sec 37.0/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:00.463 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:01.468 Waiting 1.872 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:03.340 tigers_fury Fluffy_Pillow 31.5/100: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:03.500 shred Fluffy_Pillow 93.2/100: 93% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:04.506 shred Fluffy_Pillow 79.2/100: 79% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:05.514 lunar_inspiration Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:06.517 healing_touch Fluffy_Pillow 61.0/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
2:07.443 Waiting 1.700 sec 71.0/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:09.143 rip Fluffy_Pillow 89.5/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:10.147 rake Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:11.153 shred Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury
2:12.159 Waiting 1.117 sec 17.2/100: 17% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness
2:13.276 shred Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness
2:14.282 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
2:15.286 healing_touch Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
2:17.999 savage_roar Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
2:21.306 rake Fluffy_Pillow 36.5/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:22.311 Waiting 1.661 sec 12.4/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:23.972 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:27.272 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:28.277 Waiting 1.185 sec 12.1/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:29.462 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:30.388 Waiting 0.500 sec 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
2:30.888 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
2:31.893 rip Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar, cleansed_sisters_blessing
2:32.898 Waiting 0.400 sec 23.8/100: 24% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:33.298 tigers_fury Fluffy_Pillow 28.7/100: 29% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
2:33.500 shred Fluffy_Pillow 91.1/100: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:34.505 lunar_inspiration Fluffy_Pillow 78.3/100: 78% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:35.510 shred Fluffy_Pillow 75.5/100: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:36.515 shred Fluffy_Pillow 62.6/100: 63% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:37.519 healing_touch Fluffy_Pillow 34.8/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:38.348 Waiting 0.500 sec 44.8/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_sisters_blessing
2:38.848 rip Fluffy_Pillow 50.9/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, cleansed_sisters_blessing
2:39.855 ashamanes_frenzy Fluffy_Pillow 33.1/100: 33% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:40.860 rake Fluffy_Pillow 45.2/100: 45% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_sisters_blessing
2:41.866 Waiting 1.560 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:43.426 shred Fluffy_Pillow 39.1/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
2:44.430 healing_touch Fluffy_Pillow 50.0/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness
2:45.355 savage_roar Fluffy_Pillow 60.0/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
2:46.359 rake Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:47.363 shred Fluffy_Pillow 46.8/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:48.368 Waiting 1.169 sec 17.7/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:49.537 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:50.543 Waiting 2.658 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:53.201 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:54.205 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
2:55.130 rip Fluffy_Pillow 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:56.644 rake Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_wisps_blessing
2:57.648 Waiting 2.464 sec 13.4/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
3:00.112 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:01.118 Waiting 1.680 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:02.798 lunar_inspiration Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:03.801 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:04.806 tigers_fury Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:04.806 berserk Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
3:04.806 shred Fluffy_Pillow 71.1/150: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
3:05.812 healing_touch Fluffy_Pillow 77.0/150: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:06.739 rip Fluffy_Pillow 87.1/150: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, jacins_ruse
3:07.743 shadowmeld Fluffy_Pillow 98.0/150: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:07.743 rake Fluffy_Pillow 98.0/150: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:07.743 auto_attack Fluffy_Pillow 80.5/150: 54% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:08.746 shred Fluffy_Pillow 106.4/150: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:09.751 shred Fluffy_Pillow 97.3/150: 65% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, tigers_fury, jacins_ruse
3:10.755 shred Fluffy_Pillow 88.2/150: 59% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, tigers_fury, jacins_ruse
3:11.758 healing_touch Fluffy_Pillow 79.1/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, tigers_fury, jacins_ruse
3:12.683 savage_roar Fluffy_Pillow 89.1/150: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, tigers_fury, jacins_ruse
3:13.685 shred Fluffy_Pillow 80.0/150: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, jacins_ruse
3:14.689 shred Fluffy_Pillow 70.9/150: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse
3:15.695 shred Fluffy_Pillow 61.8/150: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:16.699 lunar_inspiration Fluffy_Pillow 52.7/150: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar
3:17.703 healing_touch Fluffy_Pillow 48.6/150: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:18.627 ferocious_bite Fluffy_Pillow 58.6/150: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:19.630 rake Fluffy_Pillow 44.5/150: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:20.636 Waiting 0.200 sec 37.9/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:20.836 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:21.841 Waiting 1.289 sec 11.0/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:23.130 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
3:24.135 Waiting 0.400 sec 35.9/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:24.535 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:25.540 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
3:26.465 rip Fluffy_Pillow 21.2/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
3:27.979 rake Fluffy_Pillow 37.6/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:28.984 Waiting 1.557 sec 13.5/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:30.541 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:31.545 Waiting 2.660 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:34.205 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:35.211 tigers_fury Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing, jacins_ruse
3:35.211 shred Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
3:36.216 healing_touch Fluffy_Pillow 57.0/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing, jacins_ruse
3:37.143 savage_roar Fluffy_Pillow 67.1/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, cleansed_wisps_blessing
3:38.147 rake Fluffy_Pillow 53.0/100: 53% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
3:39.151 shred Fluffy_Pillow 43.9/100: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
3:40.156 Waiting 2.342 sec 14.8/100: 15% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
3:42.498 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_wisps_blessing
3:43.502 Waiting 1.782 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
3:45.284 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
3:46.288 shred Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_wisps_blessing
3:47.291 healing_touch Fluffy_Pillow 22.2/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_wisps_blessing
3:48.217 rip Fluffy_Pillow 32.3/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_wisps_blessing
3:51.261 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:52.267 shred Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
3:53.270 Waiting 0.568 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:53.838 shred Fluffy_Pillow 28.3/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
3:54.842 healing_touch Fluffy_Pillow 39.2/100: 39% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:55.770 Waiting 3.700 sec 49.2/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:59.470 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:00.474 ashamanes_frenzy Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:01.480 rake Fluffy_Pillow 81.2/100: 81% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:02.483 lunar_inspiration Fluffy_Pillow 57.1/100: 57% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
4:03.488 healing_touch Fluffy_Pillow 68.0/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:04.412 savage_roar Fluffy_Pillow 78.0/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
4:05.416 rake Fluffy_Pillow 48.9/100: 49% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:06.419 tigers_fury Fluffy_Pillow 24.8/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:06.419 shred Fluffy_Pillow 84.8/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:07.423 shred Fluffy_Pillow 70.7/100: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:08.427 shred Fluffy_Pillow 96.6/100: 97% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:09.432 healing_touch Fluffy_Pillow 82.5/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:10.356 rip Fluffy_Pillow 92.5/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:11.359 shred Fluffy_Pillow 73.4/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:12.363 lunar_inspiration Fluffy_Pillow 84.3/100: 84% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
4:13.367 shred Fluffy_Pillow 65.2/100: 65% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:14.372 Waiting 0.400 sec 36.1/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:14.772 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:15.777 healing_touch Fluffy_Pillow 11.4/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:16.703 Waiting 1.231 sec 21.4/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:17.934 savage_roar Fluffy_Pillow 34.8/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:18.937 rake Fluffy_Pillow 45.6/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:19.942 Waiting 1.717 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:21.659 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:22.662 Waiting 2.683 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:25.345 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:26.348 Waiting 1.283 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:27.631 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
4:28.635 healing_touch Fluffy_Pillow 35.9/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:29.561 rake Fluffy_Pillow 45.9/100: 46% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
4:30.565 Waiting 0.791 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, cleansed_ancients_blessing
4:31.356 rip Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, cleansed_ancients_blessing
4:32.361 Waiting 2.659 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:35.020 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:36.025 Waiting 1.281 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:37.306 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
4:37.306 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
4:38.311 shred Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:39.315 shred Fluffy_Pillow 96.8/100: 97% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:40.318 healing_touch Fluffy_Pillow 82.7/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:41.244 rip Fluffy_Pillow 92.7/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:42.248 rake Fluffy_Pillow 73.6/100: 74% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
4:43.250 lunar_inspiration Fluffy_Pillow 49.5/100: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
4:44.256 Waiting 0.900 sec 30.4/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
4:45.156 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, cleansed_sisters_blessing
4:46.162 healing_touch Fluffy_Pillow 13.2/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
4:46.992 savage_roar Fluffy_Pillow 23.3/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
4:47.998 rake Fluffy_Pillow 35.5/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
4:49.003 shred Fluffy_Pillow 47.6/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
4:50.007 Waiting 1.731 sec 19.8/100: 20% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, cleansed_sisters_blessing
4:51.738 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:52.743 healing_touch Fluffy_Pillow 12.9/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
4:53.573 Waiting 3.068 sec 23.0/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing
4:56.641 rip Fluffy_Pillow 57.4/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:57.644 rake Fluffy_Pillow 68.3/100: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:58.649 lunar_inspiration Fluffy_Pillow 44.2/100: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:59.652 shred Fluffy_Pillow 25.1/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:00.656 Waiting 0.400 sec 36.0/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:01.056 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:02.062 Waiting 2.669 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:04.731 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:05.735 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:06.660 Waiting 0.457 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
5:07.117 tigers_fury Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
5:07.306 Waiting 0.100 sec 88.1/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_ancients_blessing
5:07.406 rip Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, cleansed_ancients_blessing
5:08.410 shadowmeld Fluffy_Pillow 85.1/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
5:08.410 rake Fluffy_Pillow 85.1/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
5:08.410 auto_attack Fluffy_Pillow 50.1/100: 50% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing
5:09.415 lunar_inspiration Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:10.420 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
5:11.425 shred Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
5:12.430 healing_touch Fluffy_Pillow 81.8/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:13.354 savage_roar Fluffy_Pillow 91.8/100: 92% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), tigers_fury
5:14.356 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
5:15.362 ashamanes_frenzy Fluffy_Pillow 70.9/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:16.479 shred Fluffy_Pillow 83.0/100: 83% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:17.483 healing_touch Fluffy_Pillow 53.9/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:18.409 Waiting 1.900 sec 64.0/100: 64% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:20.309 rip Fluffy_Pillow 84.6/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:21.313 rake Fluffy_Pillow 65.5/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:22.316 shred Fluffy_Pillow 41.4/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:23.322 lunar_inspiration Fluffy_Pillow 52.3/100: 52% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:24.326 healing_touch Fluffy_Pillow 33.2/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing
5:25.250 Waiting 4.300 sec 43.2/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing
5:29.550 savage_roar Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_ancients_blessing, jacins_ruse
5:30.555 rake Fluffy_Pillow 60.8/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
5:31.559 Waiting 0.400 sec 36.7/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:31.959 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:32.963 Waiting 2.603 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:35.566 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:36.571 Waiting 1.281 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:37.852 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:37.852 lunar_inspiration Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:38.854 ferocious_bite Fluffy_Pillow 80.9/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:39.857 shred Fluffy_Pillow 56.8/100: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:40.862 shred Fluffy_Pillow 42.7/100: 43% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:43.913 rake Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:44.918 Waiting 2.227 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:47.145 shred Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
5:48.147 shred Fluffy_Pillow 46.7/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:49.150 healing_touch Fluffy_Pillow 17.6/100: 18% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:50.076 Waiting 2.400 sec 27.7/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:52.476 savage_roar Fluffy_Pillow 53.7/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:54.504 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:55.509 Waiting 1.333 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:56.842 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:57.847 Waiting 1.798 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:59.645 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:00.650 Waiting 2.659 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:03.309 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:04.314 Waiting 1.281 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:06.618 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:07.624 tigers_fury Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:07.852 berserk Fluffy_Pillow 74.5/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:07.852 potion Fluffy_Pillow 74.5/150: 50% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
6:07.852 healing_touch Fluffy_Pillow 74.5/150: 50% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:08.778 shred Fluffy_Pillow 84.5/150: 56% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:09.783 rip Fluffy_Pillow 90.4/150: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:10.786 lunar_inspiration Fluffy_Pillow 101.3/150: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:11.790 shred Fluffy_Pillow 112.2/150: 75% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:12.794 shred Fluffy_Pillow 103.1/150: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:13.799 shred Fluffy_Pillow 114.0/150: 76% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:14.806 healing_touch Fluffy_Pillow 125.0/150: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:15.733 savage_roar Fluffy_Pillow 135.0/150: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, jacins_ruse, potion_of_the_old_war
6:16.738 rake Fluffy_Pillow 125.9/150: 84% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:17.742 shred Fluffy_Pillow 136.8/150: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:18.745 shred Fluffy_Pillow 127.7/150: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:19.749 shred Fluffy_Pillow 118.6/150: 79% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:20.752 healing_touch Fluffy_Pillow 109.5/150: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:21.678 ferocious_bite Fluffy_Pillow 119.5/150: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), berserk, savage_roar, jacins_ruse, potion_of_the_old_war
6:22.682 rake Fluffy_Pillow 117.9/150: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:23.686 lunar_inspiration Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:24.691 shred Fluffy_Pillow 81.8/100: 82% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
6:25.696 shred Fluffy_Pillow 54.0/100: 54% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
6:26.701 healing_touch Fluffy_Pillow 26.2/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
6:27.531 Waiting 4.300 sec 36.2/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse, potion_of_the_old_war
6:31.831 ferocious_bite Fluffy_Pillow 88.3/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, potion_of_the_old_war
6:32.836 ashamanes_frenzy Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, cleansed_sisters_blessing, potion_of_the_old_war
6:33.839 shred Fluffy_Pillow 62.6/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
6:34.843 healing_touch Fluffy_Pillow 34.8/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
6:35.682 Waiting 0.500 sec 44.8/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:36.182 ferocious_bite Fluffy_Pillow 50.2/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:37.699 tigers_fury Fluffy_Pillow 16.7/100: 17% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:37.852 rake Fluffy_Pillow 78.4/100: 78% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:38.857 lunar_inspiration Fluffy_Pillow 69.3/100: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:39.862 shred Fluffy_Pillow 65.2/100: 65% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:40.867 healing_touch Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
6:41.792 savage_roar Fluffy_Pillow 61.1/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
6:42.796 rake Fluffy_Pillow 72.0/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
6:43.801 shred Fluffy_Pillow 47.9/100: 48% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
6:44.806 Waiting 0.867 sec 18.8/100: 19% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
6:45.673 shred Fluffy_Pillow 28.2/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
6:46.678 Waiting 0.100 sec 39.2/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:46.778 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:47.784 healing_touch Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:48.709 Waiting 5.450 sec 21.2/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:54.159 ferocious_bite Fluffy_Pillow 80.3/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:55.163 rake Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
6:56.166 Waiting 1.225 sec 17.1/100: 17% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:57.391 lunar_inspiration Fluffy_Pillow 30.4/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:58.395 Waiting 2.661 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:01.056 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
7:02.061 Waiting 2.272 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing
7:04.333 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
7:05.338 healing_touch Fluffy_Pillow 12.9/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, cleansed_sisters_blessing, jacins_ruse
7:07.185 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar, cleansed_sisters_blessing, jacins_ruse
7:08.191 tigers_fury Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, cleansed_sisters_blessing, jacins_ruse
7:08.191 Waiting 1.000 sec 72.4/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
7:09.191 savage_roar Fluffy_Pillow 99.6/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury, cleansed_sisters_blessing, jacins_ruse
7:10.194 shadowmeld Fluffy_Pillow 86.7/100: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, cleansed_sisters_blessing, jacins_ruse
7:10.194 rake Fluffy_Pillow 86.7/100: 87% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, cleansed_sisters_blessing, jacins_ruse
7:10.194 auto_attack Fluffy_Pillow 51.7/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, cleansed_sisters_blessing, jacins_ruse
7:11.198 ferocious_bite Fluffy_Pillow 77.8/100: 78% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
7:12.203 lunar_inspiration Fluffy_Pillow 38.7/100: 39% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
7:13.206 Waiting 1.896 sec 19.6/100: 20% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
7:15.102 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
7:16.106 Waiting 2.682 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, cleansed_ancients_blessing, jacins_ruse
7:18.788 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, cleansed_ancients_blessing, jacins_ruse
7:19.792 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:20.718 Waiting 1.356 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:22.074 lunar_inspiration Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:23.078 Waiting 2.160 sec 16.7/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:25.238 savage_roar Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:28.542 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
7:29.548 Waiting 1.201 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 34.71% 34.71% 6549
Haste 8.53% 8.53% 2771
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 21649 19943 0
Mastery 53.58% 51.42% 6200
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 846.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Nature's Call
ilevel: 865, stats: { +329 Mastery, +329 Haste, +329 Crit }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="natures_call_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=natures_call,id=139334,bonus_id=1805,ilevel=865
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=845.67
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=6549
# gear_haste_rating=1847
# gear_mastery_rating=6200
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

ravaged_seed_pod_865 : 297881 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
297881.2 297881.2 377.9 / 0.127% 38040.8 / 12.8% 20006.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.9 14.9 Energy 30.59% 44.2 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ravaged_seed_pod_865 297881
Ashamane's Frenzy 13877 4.7% 6.1 78.51sec 1022612 1018117 Direct 91.3 9518 19035 12725 33.7%  
Periodic 30.2 125990 251495 168487 33.9% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.11 91.26 121.43 30.17 1.0045 0.6472 6244113.30 6790075.21 8.04 73705.55 1018117.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.51 66.30% 9518.48 7081 11329 9519.38 8517 10499 575995 846767 31.98
crit 30.75 33.70% 19034.70 14161 22657 19034.48 17046 21470 585392 860582 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.0 66.14% 125990.42 78070 156132 126014.62 111871 141349 2513747 2513747 0.00
crit 10.2 33.86% 251495.02 156140 312264 251413.59 209488 292573 2568979 2568979 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 34432 11.6% 18.6 22.83sec 834010 0 Periodic 145.3 79641 159215 106583 33.9% 41.6%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.57 0.00 145.34 145.34 0.0000 1.2892 15491090.29 15491090.29 0.00 82677.35 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.1 66.14% 79640.77 55 94573 79579.04 71430 86752 7655991 7655991 0.00
crit 49.2 33.86% 159215.05 82 189146 159015.43 131191 176830 7835099 7835099 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 27900 9.4% 514.2 0.87sec 24404 27967 Direct 514.2 18231 36462 24403 33.9%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 514.23 514.23 0.00 0.00 0.8726 0.0000 12549334.55 18448710.50 31.98 27966.59 27966.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 340.13 66.14% 18231.39 14216 20436 18231.05 17877 18507 6200984 9116034 31.98
crit 174.11 33.86% 36462.39 28433 40872 36463.39 35563 37252 6348350 9332676 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6270 2.1% 10.6 44.98sec 266171 264999 Direct 10.6 189056 418849 266181 33.6%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.58 10.58 0.00 0.00 1.0045 0.0000 2815616.47 4139222.92 31.98 264999.20 264999.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.03 66.43% 189056.12 14615 251221 188617.97 0 251221 1328532 1953067 31.96
crit 3.55 33.57% 418849.42 33609 555198 409521.21 0 555198 1487085 2186156 31.30
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Infested Ground 5280 1.8% 7.9 60.65sec 302101 0 Direct 77.7 22835 45694 30566 33.8%  

Stats details: infested_ground

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.86 77.67 0.00 0.00 0.0000 0.0000 2374009.60 2374009.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.41 66.19% 22834.50 16725 24042 22834.16 21820 23520 1173872 1173872 0.00
crit 26.26 33.81% 45694.32 33450 48085 45693.39 42516 47517 1200137 1200137 0.00
 
 

Action details: infested_ground

Static Values
  • id:221803
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221803
  • name:Infested Ground
  • school:shadow
  • tooltip:
  • description:Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.
 
Moonfire (lunar_inspiration) 22298 7.5% 31.6 14.35sec 317283 315863 Direct 31.6 32993 66021 44112 33.7%  
Periodic 253.6 25451 50886 34050 33.8% 96.9%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.61 31.61 253.60 253.60 1.0045 1.7188 10029902.67 10029902.67 0.00 21447.41 315862.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.97 66.32% 32993.18 25727 36982 32991.09 30997 34872 691742 691742 0.00
crit 10.65 33.68% 66021.39 51454 73964 66049.10 57885 73964 702829 702829 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 167.9 66.19% 25451.02 98 28764 25450.65 24728 26275 4272378 4272378 0.00
crit 85.7 33.81% 50886.38 195 57529 50886.58 48199 52636 4362953 4362953 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2194 0.7% 24.2 18.32sec 40724 0 Periodic 71.7 13772 0 13772 0.0% 7.9%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.25 0.00 71.70 71.70 0.0000 0.4971 987476.40 1451683.84 31.98 27703.86 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.7 100.00% 13771.60 27 15493 13775.01 12803 14502 987476 1451684 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11219 3.7% 23.8 17.15sec 209502 0 Direct 23.8 156773 313574 209505 33.6%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.78 23.78 0.00 0.00 0.0000 0.0000 4982106.31 7324168.19 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.78 66.37% 156772.96 122075 175482 156784.31 144506 168615 2474383 3637578 31.98
crit 8.00 33.63% 313573.84 244149 350964 313371.84 0 350964 2507723 3686590 31.96
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 66033 22.2% 47.2 9.55sec 629122 626309 Direct 47.2 81643 162744 109087 33.8%  
Periodic 223.7 82004 164264 109792 33.8% 94.9%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.22 47.22 223.67 223.67 1.0045 1.9085 29707699.39 29707699.39 0.00 62634.83 626308.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.24 66.16% 81642.83 38283 183748 81670.50 69764 98434 2550577 2550577 0.00
crit 15.98 33.84% 162744.04 76565 367495 162842.95 130244 223903 2600591 2600591 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.1 66.22% 82004.13 40 183748 82021.02 74071 89820 12146196 12146196 0.00
crit 75.6 33.78% 164263.69 71 367495 164326.09 139475 193542 12410336 12410336 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 79389 26.7% 22.8 15.49sec 1564028 1557087 Periodic 326.5 81804 163625 109451 33.8% 96.1%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.85 0.00 326.50 326.50 1.0045 1.3243 35736696.44 35736696.44 0.00 78481.82 1557086.68
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 216.2 66.21% 81803.52 55 94573 81796.80 74875 85445 17683903 17683903 0.00
crit 110.3 33.79% 163625.11 127 189146 163613.02 151578 173370 18052793 18052793 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 28991 9.7% 110.2 4.08sec 118279 117750 Direct 110.2 88462 176885 118282 33.7%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.15 110.15 0.00 0.00 1.0045 0.0000 13028880.03 19153687.77 31.98 117749.64 117749.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.01 66.28% 88461.80 61977 133637 88478.27 82724 95185 6458703 9494905 31.98
crit 37.14 33.72% 176884.71 123954 267275 176807.10 161236 193677 6570177 9658783 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
ravaged_seed_pod_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ravaged_seed_pod_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 181.95sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ravaged_seed_pod_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ravaged_seed_pod_865
  • harmful:false
  • if_expr:
 
Healing Touch 50.2 9.09sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.22 0.00 0.00 0.00 0.8661 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.6 24.70sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.56 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.47sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.33sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.11% 10.19% 45.4(45.4) 15.1

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.80% 14.91% 0.0(0.0) 2.9

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 50.2 0.0 9.0sec 9.1sec 45.61% 45.65% 0.0(0.0) 0.0

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.80%
  • bloodtalons_2:26.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 43.7 1.3 10.1sec 9.8sec 6.35% 15.26% 1.3(1.3) 0.0

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.35%

Trigger Attempt Success

  • trigger_pct:8.76%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.7 1.8 63.5sec 48.6sec 24.62% 24.70% 1.8(1.8) 6.4

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Leeching Pestilence 7.9 0.0 60.7sec 60.7sec 17.29% 17.38% 0.0(0.0) 7.7

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_leeching_pestilence
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:leech_rating
  • amount:1771.29

Stack Uptimes

  • leeching_pestilence_1:17.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221805
  • name:Leeching Pestilence
  • tooltip:Leech increased by $w1.
  • description:{$@spelldesc221803=Contaminate the ground beneath your feet for {$d=10 seconds}, dealing {$s2=9486} Shadow damage to enemies in the area each second. While you remain in this area, you gain {$s3=1061} Leech.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.7sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 49.9 1.2 9.0sec 8.8sec 74.56% 74.57% 1.2(1.2) 0.0

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.56%

Trigger Attempt Success

  • trigger_pct:98.39%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.2 10.3 47.5sec 24.7sec 93.27% 93.00% 201.7(201.7) 7.3

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.7sec 133.7sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.81% 29.14% 0.0(0.0) 14.9

Buff details

  • buff initial source:ravaged_seed_pod_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
ravaged_seed_pod_865
ferocious_bite Energy 21.2 356.6 16.9 33.7 7895.3
ferocious_bite Combo Points 10.6 48.7 4.6 4.6 57780.6
lunar_inspiration Energy 31.6 779.2 24.6 24.6 12872.6
rake Energy 47.2 1346.1 28.5 28.5 22069.0
rip Energy 22.8 464.0 20.3 20.3 77015.0
rip Combo Points 22.8 114.2 5.0 5.0 312797.7
savage_roar Energy 18.6 479.3 25.8 25.8 0.0
savage_roar Combo Points 18.6 92.8 5.0 5.0 0.0
shred Energy 110.1 3269.9 29.7 29.7 3984.5
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.22 47.22 (18.23%) 1.00 0.00 0.00%
tigers_fury Energy 15.21 912.36 (11.20%) 59.97 0.52 0.06%
ashamanes_frenzy Combo Points 6.11 18.32 (7.07%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.61 31.61 (12.21%) 1.00 0.00 0.00%
shred Combo Points 110.15 110.15 (42.53%) 1.00 0.00 0.00%
energy_regen Energy 2060.82 5078.88 (62.36%) 2.46 72.09 1.40%
clearcasting Energy 43.65 1491.06 (18.31%) 34.16 0.00 0.00%
ashamanes_energy Energy 45.44 662.28 (8.13%) 14.58 19.25 2.82%
primal_fury Combo Points 63.77 51.67 (19.95%) 0.81 12.10 18.97%
Resource RPS-Gain RPS-Loss
Energy 14.79 14.88
Combo Points 0.58 0.57
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 35.12 0.03 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.23 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
clearcasting 45.1 9.8sec
clearcasting_wasted 1.3 124.4sec
primal_fury 63.8 7.0sec

Statistics & Data Analysis

Fight Length
Sample Data ravaged_seed_pod_865 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data ravaged_seed_pod_865 Damage Per Second
Count 2499
Mean 297881.16
Minimum 269685.80
Maximum 328507.57
Spread ( max - min ) 58821.77
Range [ ( max - min ) / 2 * 100% ] 9.87%
Standard Deviation 9638.8043
5th Percentile 282233.90
95th Percentile 314038.01
( 95th Percentile - 5th Percentile ) 31804.11
Mean Distribution
Standard Deviation 192.8147
95.00% Confidence Intervall ( 297503.25 - 298259.07 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4022
0.1 Scale Factor Error with Delta=300 793103
0.05 Scale Factor Error with Delta=300 3172414
0.01 Scale Factor Error with Delta=300 79310373
Priority Target DPS
Sample Data ravaged_seed_pod_865 Priority Target Damage Per Second
Count 2499
Mean 297881.16
Minimum 269685.80
Maximum 328507.57
Spread ( max - min ) 58821.77
Range [ ( max - min ) / 2 * 100% ] 9.87%
Standard Deviation 9638.8043
5th Percentile 282233.90
95th Percentile 314038.01
( 95th Percentile - 5th Percentile ) 31804.11
Mean Distribution
Standard Deviation 192.8147
95.00% Confidence Intervall ( 297503.25 - 298259.07 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4022
0.1 Scale Factor Error with Delta=300 793103
0.05 Scale Factor Error with Delta=300 3172414
0.01 Scale Factor Error with Delta=300 79310373
DPS(e)
Sample Data ravaged_seed_pod_865 Damage Per Second (Effective)
Count 2499
Mean 297881.16
Minimum 269685.80
Maximum 328507.57
Spread ( max - min ) 58821.77
Range [ ( max - min ) / 2 * 100% ] 9.87%
Damage
Sample Data ravaged_seed_pod_865 Damage
Count 2499
Mean 133946925.44
Minimum 98329599.12
Maximum 169934262.87
Spread ( max - min ) 71604663.75
Range [ ( max - min ) / 2 * 100% ] 26.73%
DTPS
Sample Data ravaged_seed_pod_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ravaged_seed_pod_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ravaged_seed_pod_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ravaged_seed_pod_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ravaged_seed_pod_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ravaged_seed_pod_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ravaged_seed_pod_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data ravaged_seed_pod_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.56 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.56 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 7.86 use_item,slot=trinket1,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
C 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
D 15.22 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
E 4.04 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
F 49.22 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
J 8.24 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
K 22.85 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
L 10.31 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
M 6.54 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
N 6.11 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
O 3.56 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
P 42.66 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
Q 31.61 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
R 110.15 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789QRJRDABFNKRRRPFMQPRRFKRRRRFLPQRRFKPDRRRFKO89QRRFLRRRPFKPQDBRRFKPRRFJPQRFKNRFLPQDPRRFKRRQRFLPRRQFKPRDBRRFKPRQRFLPRQRFKPDRRFKNQRFLPRRRFKPQRDABFKO89RRRFJQRRRFMPRRFKPQRRFLPRDRRFKPQRRFKNPQFJPRDBQFKPRRFLRPRQFKPRRRFLDPQRRFKPQRRFKPRQDBRFJNO89RFKRRQRFLPRRQFPDKRRRRFLPQERPQFMDABCPRRFLPQRRFMRRRRRFMNPFLQPRRDRFMPRQRFLPRREQPRDBRFMO89QRRFLRRRRF

Sample Sequence Table

time name target resources buffs
Pre flask ravaged_seed_pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food ravaged_seed_pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation ravaged_seed_pod_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.004 lunar_inspiration Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 61.2/100: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, bloodtalons, potion_of_the_old_war
0:03.014 savage_roar Fluffy_Pillow 75.7/100: 76% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, potion_of_the_old_war
0:04.021 shred Fluffy_Pillow 50.3/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:05.024 tigers_fury Fluffy_Pillow 24.9/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:05.024 berserk Fluffy_Pillow 84.9/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:05.024 use_item_ravaged_seed_pod Fluffy_Pillow 84.9/150: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:05.024 healing_touch Fluffy_Pillow 84.9/150: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:05.779 ashamanes_frenzy Fluffy_Pillow 95.8/150: 64% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:06.784 rip Fluffy_Pillow 125.4/150: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:07.789 shred Fluffy_Pillow 140.0/150: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:08.794 shred Fluffy_Pillow 149.5/150: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:09.800 shred Fluffy_Pillow 144.1/150: 96% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:10.806 rake Fluffy_Pillow 138.7/150: 92% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:11.809 healing_touch Fluffy_Pillow 135.8/150: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:12.564 ferocious_bite Fluffy_Pillow 146.7/150: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
0:13.569 lunar_inspiration Fluffy_Pillow 136.3/150: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, bloodtalons, berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
0:14.573 rake Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
0:15.579 shred Fluffy_Pillow 147.1/150: 98% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.583 shred Fluffy_Pillow 141.6/150: 94% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.587 healing_touch Fluffy_Pillow 136.2/150: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.341 rip Fluffy_Pillow 147.1/150: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
0:19.346 shred Fluffy_Pillow 146.7/150: 98% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.350 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:21.356 shred Fluffy_Pillow 74.6/100: 75% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.361 shred Fluffy_Pillow 49.2/100: 49% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.368 healing_touch Fluffy_Pillow 23.8/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.121 Waiting 1.000 sec 34.7/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:25.121 savage_roar Fluffy_Pillow 49.2/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar
0:26.126 rake Fluffy_Pillow 63.8/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:27.132 lunar_inspiration Fluffy_Pillow 43.4/100: 43% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:28.136 Waiting 0.900 sec 27.9/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:29.036 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:30.042 shred Fluffy_Pillow 15.6/100: 16% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:31.046 healing_touch Fluffy_Pillow 30.1/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:31.800 Waiting 0.300 sec 41.1/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:32.100 rip Fluffy_Pillow 45.4/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:33.615 rake Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:34.620 Waiting 0.555 sec 16.9/100: 17% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar
0:35.175 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar
0:35.175 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:36.180 shred Fluffy_Pillow 74.6/100: 75% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:37.182 shred Fluffy_Pillow 64.1/100: 64% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:38.185 healing_touch Fluffy_Pillow 53.7/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:38.939 rip Fluffy_Pillow 64.6/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, tigers_fury
0:39.943 shadowmeld Fluffy_Pillow 79.1/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:39.943 rake Fluffy_Pillow 79.1/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:39.943 auto_attack Fluffy_Pillow 44.1/100: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:40.948 lunar_inspiration Fluffy_Pillow 58.7/100: 59% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:41.953 Waiting 0.100 sec 39.9/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
0:42.053 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
0:43.058 Waiting 2.542 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
0:45.600 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:46.604 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:47.503 Waiting 1.882 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:49.385 savage_roar Fluffy_Pillow 42.8/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:50.390 shred Fluffy_Pillow 54.1/100: 54% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
0:51.394 shred Fluffy_Pillow 65.3/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
0:52.399 Waiting 0.400 sec 36.5/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:52.799 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:56.102 rake Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:57.105 healing_touch Fluffy_Pillow 14.0/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
0:58.006 Waiting 1.900 sec 24.0/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:59.906 rip Fluffy_Pillow 45.2/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:01.931 rake Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:02.935 Waiting 0.985 sec 14.0/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:03.920 lunar_inspiration Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
1:04.924 Waiting 0.100 sec 36.2/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:05.024 tigers_fury Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:05.175 use_item_ravaged_seed_pod Fluffy_Pillow 99.0/100: 99% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:05.175 shred Fluffy_Pillow 99.0/100: 99% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:06.179 shred Fluffy_Pillow 85.2/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:07.182 healing_touch Fluffy_Pillow 71.4/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:08.082 Waiting 0.100 sec 81.4/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
1:08.182 rip Fluffy_Pillow 97.5/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
1:09.186 rake Fluffy_Pillow 78.7/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:10.191 shred Fluffy_Pillow 54.9/100: 55% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:11.195 Waiting 1.300 sec 26.1/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:12.495 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
1:13.500 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, leeching_pestilence
1:14.399 Waiting 0.678 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, leeching_pestilence
1:15.588 savage_roar Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
1:16.592 rake Fluffy_Pillow 46.4/100: 46% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:17.595 Waiting 0.720 sec 22.5/100: 23% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:18.315 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:19.319 Waiting 2.585 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
1:21.904 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
1:22.906 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
1:23.807 rip Fluffy_Pillow 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:24.811 ashamanes_frenzy Fluffy_Pillow 33.0/100: 33% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:25.816 shred Fluffy_Pillow 44.3/100: 44% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:26.821 healing_touch Fluffy_Pillow 15.5/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:27.722 Waiting 1.400 sec 25.5/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:29.122 savage_roar Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:32.168 rake Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:33.171 Waiting 1.727 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:34.898 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:35.901 tigers_fury Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:35.901 rake Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:36.907 shred Fluffy_Pillow 63.0/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:37.911 shred Fluffy_Pillow 49.2/100: 49% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:38.916 healing_touch Fluffy_Pillow 75.4/100: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:39.815 Waiting 0.400 sec 85.4/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:40.215 rip Fluffy_Pillow 89.9/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:41.219 shred Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:42.224 shred Fluffy_Pillow 42.3/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:43.229 Waiting 1.530 sec 13.5/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:44.759 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:45.764 Waiting 2.584 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:48.348 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:49.352 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:50.253 Waiting 1.680 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:51.933 savage_roar Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:55.235 rake Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:56.238 Waiting 1.018 sec 13.6/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:57.256 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
1:58.260 Waiting 0.300 sec 36.2/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:58.560 shred Fluffy_Pillow 39.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
1:59.565 lunar_inspiration Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:00.573 healing_touch Fluffy_Pillow 32.0/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:01.473 rip Fluffy_Pillow 42.0/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
2:02.986 rake Fluffy_Pillow 28.9/100: 29% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:03.990 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:04.995 Waiting 1.226 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:06.221 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:06.221 use_item_ravaged_seed_pod Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:06.221 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:07.224 shred Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:08.230 healing_touch Fluffy_Pillow 57.4/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:09.131 Waiting 0.600 sec 67.5/100: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:09.731 rip Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:10.735 rake Fluffy_Pillow 70.4/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:11.740 shred Fluffy_Pillow 46.6/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:12.745 Waiting 1.147 sec 17.8/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
2:13.892 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
2:14.896 Waiting 1.185 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, leeching_pestilence
2:16.081 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, leeching_pestilence
2:17.086 healing_touch Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:17.987 Waiting 3.900 sec 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:21.887 savage_roar Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:22.892 rake Fluffy_Pillow 61.0/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:23.896 Waiting 0.300 sec 37.2/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:24.196 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:25.201 Waiting 1.689 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:26.890 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:27.894 shred Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
2:28.897 healing_touch Fluffy_Pillow 23.0/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:29.798 Waiting 0.900 sec 33.0/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:30.698 rip Fluffy_Pillow 43.1/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:32.728 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:33.733 Waiting 2.272 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:36.005 tigers_fury Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:36.221 shred Fluffy_Pillow 99.7/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:37.224 shred Fluffy_Pillow 85.9/100: 86% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:38.230 healing_touch Fluffy_Pillow 72.1/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:39.130 Waiting 0.100 sec 82.1/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:39.230 rip Fluffy_Pillow 98.2/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
2:40.235 ashamanes_frenzy Fluffy_Pillow 79.4/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
2:41.242 lunar_inspiration Fluffy_Pillow 90.7/100: 91% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
2:42.248 shred Fluffy_Pillow 71.9/100: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
2:43.254 healing_touch Fluffy_Pillow 43.1/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
2:44.155 savage_roar Fluffy_Pillow 53.2/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
2:45.160 rake Fluffy_Pillow 64.4/100: 64% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:46.165 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:47.168 Waiting 2.583 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:49.751 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:50.755 Waiting 2.582 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:53.337 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:54.340 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:55.241 Waiting 0.782 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:56.023 rip Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:59.331 rake Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:00.333 Waiting 1.516 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:01.849 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:02.852 Waiting 2.587 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:05.439 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:06.444 tigers_fury Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:06.444 berserk Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:06.444 use_item_ravaged_seed_pod Fluffy_Pillow 71.8/150: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:06.444 healing_touch Fluffy_Pillow 71.8/150: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:07.344 rip Fluffy_Pillow 81.9/150: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, leeching_pestilence
3:08.348 shadowmeld Fluffy_Pillow 108.1/150: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:08.348 rake Fluffy_Pillow 108.1/150: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:08.348 auto_attack Fluffy_Pillow 90.6/150: 60% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:09.352 shred Fluffy_Pillow 116.8/150: 78% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:10.357 shred Fluffy_Pillow 123.0/150: 82% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:11.362 shred Fluffy_Pillow 114.2/150: 76% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, berserk, predatory_swiftness, tigers_fury, leeching_pestilence
3:12.368 healing_touch Fluffy_Pillow 125.4/150: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, tigers_fury, leeching_pestilence
3:13.268 savage_roar Fluffy_Pillow 135.5/150: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, tigers_fury, leeching_pestilence
3:14.271 lunar_inspiration Fluffy_Pillow 126.6/150: 84% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
3:15.278 shred Fluffy_Pillow 137.9/150: 92% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons(2), berserk, predatory_swiftness, savage_roar, leeching_pestilence
3:16.283 shred Fluffy_Pillow 149.1/150: 99% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, leeching_pestilence
3:17.287 shred Fluffy_Pillow 140.3/150: 94% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:18.292 healing_touch Fluffy_Pillow 131.5/150: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:19.193 ferocious_bite Fluffy_Pillow 141.6/150: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:20.197 rake Fluffy_Pillow 127.8/150: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:21.201 shred Fluffy_Pillow 121.5/150: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar
3:22.207 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:23.211 healing_touch Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:24.112 Waiting 0.700 sec 81.3/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:24.812 rip Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:25.817 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:26.822 lunar_inspiration Fluffy_Pillow 46.5/100: 46% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:27.827 Waiting 1.200 sec 27.7/100: 28% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:29.027 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:30.032 Waiting 1.639 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:31.671 shred Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
3:32.676 healing_touch Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:33.577 savage_roar Fluffy_Pillow 51.8/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:35.352 rake Fluffy_Pillow 31.6/100: 32% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
3:36.358 shred Fluffy_Pillow 42.9/100: 43% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
3:37.361 tigers_fury Fluffy_Pillow 14.1/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:37.361 shred Fluffy_Pillow 74.1/100: 74% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:38.365 shred Fluffy_Pillow 60.3/100: 60% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:39.369 healing_touch Fluffy_Pillow 46.5/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:40.270 Waiting 1.600 sec 56.5/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
3:41.870 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
3:42.874 rake Fluffy_Pillow 70.6/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
3:43.879 lunar_inspiration Fluffy_Pillow 46.8/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
3:44.882 shred Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
3:45.887 Waiting 1.000 sec 29.2/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:46.887 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:47.891 healing_touch Fluffy_Pillow 11.5/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:48.791 Waiting 5.708 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:54.499 rip Fluffy_Pillow 85.2/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:55.504 ashamanes_frenzy Fluffy_Pillow 66.5/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:56.508 rake Fluffy_Pillow 77.7/100: 78% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:57.511 lunar_inspiration Fluffy_Pillow 53.8/100: 54% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:58.516 healing_touch Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:59.417 Waiting 1.900 sec 45.1/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
4:01.317 savage_roar Fluffy_Pillow 66.3/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
4:02.321 rake Fluffy_Pillow 37.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:03.325 Waiting 2.412 sec 13.7/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:05.737 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
4:06.742 Waiting 1.181 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:07.923 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:07.923 use_item_ravaged_seed_pod Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:07.923 lunar_inspiration Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:08.927 healing_touch Fluffy_Pillow 81.2/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:09.825 rip Fluffy_Pillow 91.2/100: 91% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
4:10.830 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:11.836 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:12.840 shred Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:13.845 healing_touch Fluffy_Pillow 42.4/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
4:14.744 Waiting 0.800 sec 52.4/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
4:15.544 savage_roar Fluffy_Pillow 61.4/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence
4:16.549 shred Fluffy_Pillow 72.6/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, leeching_pestilence
4:17.553 rake Fluffy_Pillow 43.8/100: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, leeching_pestilence
4:18.557 Waiting 1.850 sec 20.0/100: 20% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:20.407 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:21.413 Waiting 1.679 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:23.092 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:24.096 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:24.995 Waiting 2.687 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:27.682 rip Fluffy_Pillow 51.8/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:28.688 rake Fluffy_Pillow 63.0/100: 63% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:29.693 Waiting 0.100 sec 39.2/100: 39% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:29.793 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:30.798 Waiting 2.607 sec 11.5/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:33.405 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:34.411 shred Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
4:35.415 healing_touch Fluffy_Pillow 23.0/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:36.315 Waiting 0.700 sec 33.1/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:37.015 savage_roar Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:38.019 tigers_fury Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:38.019 rake Fluffy_Pillow 72.1/100: 72% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:39.024 lunar_inspiration Fluffy_Pillow 63.3/100: 63% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:40.029 shred Fluffy_Pillow 59.5/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:41.036 shred Fluffy_Pillow 45.7/100: 46% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:42.039 healing_touch Fluffy_Pillow 16.9/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:42.941 Waiting 3.900 sec 27.0/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:46.841 rip Fluffy_Pillow 70.5/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:47.845 rake Fluffy_Pillow 51.7/100: 52% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:48.849 Waiting 0.900 sec 27.9/100: 28% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:49.749 lunar_inspiration Fluffy_Pillow 37.9/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:50.753 Waiting 1.924 sec 19.1/100: 19% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:52.677 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:53.681 Waiting 2.582 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:56.263 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:57.268 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:58.168 Waiting 1.180 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:59.348 rip Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:02.137 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:03.143 shred Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
5:04.146 Waiting 0.629 sec 23.6/100: 24% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:04.775 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:05.777 Waiting 2.087 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:07.864 tigers_fury Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:08.019 use_item_ravaged_seed_pod Fluffy_Pillow 96.8/100: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:08.019 shred Fluffy_Pillow 96.8/100: 97% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:09.024 healing_touch Fluffy_Pillow 83.0/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, leeching_pestilence, jacins_ruse
5:09.926 savage_roar Fluffy_Pillow 93.0/100: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, leeching_pestilence, jacins_ruse
5:10.930 ashamanes_frenzy Fluffy_Pillow 79.2/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:11.935 shadowmeld Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:11.935 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:11.935 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:12.939 shred Fluffy_Pillow 76.2/100: 76% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:13.943 healing_touch Fluffy_Pillow 47.4/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:14.843 rip Fluffy_Pillow 57.4/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:15.849 shred Fluffy_Pillow 68.7/100: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
5:16.854 Waiting 0.100 sec 39.9/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
5:16.954 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
5:17.958 Waiting 1.648 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, leeching_pestilence, jacins_ruse
5:19.606 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:20.612 Waiting 1.183 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:21.795 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:22.799 healing_touch Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:23.701 savage_roar Fluffy_Pillow 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:24.707 rake Fluffy_Pillow 57.5/100: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:25.711 Waiting 0.600 sec 33.7/100: 34% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:26.311 shred Fluffy_Pillow 40.4/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:27.316 Waiting 2.602 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:29.918 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:30.922 Waiting 1.682 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:32.604 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:33.609 Waiting 1.184 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:34.793 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:35.693 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
5:36.698 Waiting 1.232 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:37.930 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:38.019 rip Fluffy_Pillow 86.0/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, ashamanes_energy, savage_roar, tigers_fury
5:39.023 shred Fluffy_Pillow 82.2/100: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:40.027 shred Fluffy_Pillow 68.4/100: 68% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:41.030 shred Fluffy_Pillow 54.6/100: 55% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:42.034 Waiting 1.300 sec 25.8/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:43.334 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:44.338 healing_touch Fluffy_Pillow 11.5/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:45.237 savage_roar Fluffy_Pillow 21.5/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
5:46.497 rake Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:47.500 Waiting 1.687 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:49.187 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
5:51.467 ferocious_bite Fluffy_Pillow 26.0/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
5:52.471 Waiting 2.637 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:55.108 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:56.111 Waiting 1.182 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:58.314 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:59.319 Waiting 1.612 sec 12.6/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:00.931 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:01.936 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:02.836 Waiting 2.584 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:05.420 ferocious_bite Fluffy_Pillow 50.7/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:07.957 tigers_fury Fluffy_Pillow 29.0/100: 29% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:08.019 berserk Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:08.019 use_item_ravaged_seed_pod Fluffy_Pillow 89.6/150: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:08.019 potion Fluffy_Pillow 89.6/150: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse
6:08.019 rake Fluffy_Pillow 89.6/150: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:09.026 shred Fluffy_Pillow 98.4/150: 66% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:10.030 shred Fluffy_Pillow 104.6/150: 70% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:11.036 healing_touch Fluffy_Pillow 110.8/150: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:11.936 savage_roar Fluffy_Pillow 120.8/150: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, leeching_pestilence, jacins_ruse, potion_of_the_old_war
6:12.940 rake Fluffy_Pillow 112.0/150: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:13.943 lunar_inspiration Fluffy_Pillow 105.7/150: 70% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:14.947 shred Fluffy_Pillow 101.9/150: 68% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:15.950 shred Fluffy_Pillow 93.1/150: 62% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence, potion_of_the_old_war
6:16.954 healing_touch Fluffy_Pillow 84.3/150: 56% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, leeching_pestilence, potion_of_the_old_war
6:17.854 ferocious_bite Fluffy_Pillow 94.4/150: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, leeching_pestilence, potion_of_the_old_war
6:18.858 shred Fluffy_Pillow 80.6/150: 54% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:19.863 shred Fluffy_Pillow 71.8/150: 48% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:20.867 shred Fluffy_Pillow 63.0/150: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:21.871 shred Fluffy_Pillow 54.2/150: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:22.876 shred Fluffy_Pillow 45.4/150: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:23.881 healing_touch Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:24.782 Waiting 3.800 sec 46.7/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:28.582 ferocious_bite Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, potion_of_the_old_war
6:29.588 ashamanes_frenzy Fluffy_Pillow 75.3/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:30.591 rake Fluffy_Pillow 86.5/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, potion_of_the_old_war
6:31.594 healing_touch Fluffy_Pillow 97.6/100: 98% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, potion_of_the_old_war
6:32.491 savage_roar Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, potion_of_the_old_war
6:33.496 lunar_inspiration Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:34.499 rake Fluffy_Pillow 52.4/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:35.504 Waiting 1.100 sec 28.6/100: 29% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
6:36.604 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
6:37.609 shred Fluffy_Pillow 12.1/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
6:38.613 tigers_fury Fluffy_Pillow 23.3/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:38.613 shred Fluffy_Pillow 83.3/100: 83% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:39.620 healing_touch Fluffy_Pillow 69.5/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:40.521 Waiting 0.100 sec 79.6/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:40.621 ferocious_bite Fluffy_Pillow 95.7/100: 96% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:41.625 rake Fluffy_Pillow 96.9/100: 97% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
6:42.630 shred Fluffy_Pillow 73.1/100: 73% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:43.635 lunar_inspiration Fluffy_Pillow 44.3/100: 44% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:44.640 Waiting 1.300 sec 25.5/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:45.940 shred Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
6:46.944 healing_touch Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:47.846 Waiting 5.432 sec 21.3/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
6:53.278 savage_roar Fluffy_Pillow 81.9/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
6:54.282 rake Fluffy_Pillow 93.1/100: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
6:55.287 shred Fluffy_Pillow 69.3/100: 69% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:56.292 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:57.297 Waiting 1.289 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:58.586 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:59.591 Waiting 1.736 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:01.327 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:02.332 Waiting 2.484 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:04.816 rake Fluffy_Pillow 39.5/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
7:05.821 Waiting 2.232 sec 15.7/100: 16% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:08.053 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:09.057 tigers_fury Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:09.057 use_item_ravaged_seed_pod Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:09.057 shred Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:10.063 healing_touch Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:10.964 Waiting 0.600 sec 68.1/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
7:11.564 ferocious_bite Fluffy_Pillow 89.8/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, leeching_pestilence
7:12.568 shadowmeld Fluffy_Pillow 91.0/100: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:12.568 rake Fluffy_Pillow 91.0/100: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:12.568 auto_attack Fluffy_Pillow 56.0/100: 56% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:13.572 lunar_inspiration Fluffy_Pillow 67.2/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:14.578 shred Fluffy_Pillow 48.4/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:15.582 Waiting 1.883 sec 19.6/100: 20% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, leeching_pestilence
7:17.465 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, leeching_pestilence
7:18.471 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, leeching_pestilence
7:19.372 savage_roar Fluffy_Pillow 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
7:20.375 Waiting 0.300 sec 33.1/100: 33% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:20.675 shred Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
7:21.680 shred Fluffy_Pillow 47.6/100: 48% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
7:22.685 Waiting 0.652 sec 18.8/100: 19% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:23.337 shred Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
7:24.341 Waiting 0.300 sec 37.3/100: 37% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:24.641 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
7:25.644 healing_touch Fluffy_Pillow 11.9/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:26.544 Waiting 3.578 sec 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 33.77% 33.77% 6220
Haste 11.56% 11.56% 3756
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 21649 19943 0
Mastery 51.70% 49.54% 5871
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 846.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Ravaged Seed Pod
ilevel: 865, stats: { +986 Haste }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="ravaged_seed_pod_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/use_item,slot=trinket1,if=(buff.tigers_fury.up&(target.time_to_die>trinket.stat.any.cooldown|target.time_to_die<45))|buff.incarnation.remains>20
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=ravaged_seed_pod,id=139320,bonus_id=1805,ilevel=865
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=845.67
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=6220
# gear_haste_rating=2504
# gear_mastery_rating=5871
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

spontaneous_appendages_865 : 299361 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
299360.8 299360.8 388.8 / 0.130% 38305.6 / 12.8% 20700.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.5 14.5 Energy 31.27% 42.2 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
spontaneous_appendages_865 299361
Ashamane's Frenzy 14382 4.8% 6.1 78.78sec 1060957 1056323 Direct 91.2 9867 19749 13214 33.9%  
Periodic 30.1 130620 260836 174719 33.9% 17.4%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.10 91.21 121.35 30.14 1.0045 0.6470 6471032.88 7037640.54 8.05 76451.80 1056322.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.32 66.13% 9866.72 7343 11706 9868.24 8812 10838 595139 874911 31.98
crit 30.90 33.87% 19748.62 14686 23411 19750.02 17033 21832 610166 897002 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.9 66.13% 130620.01 80962 161329 130622.67 115511 144272 2602998 2602998 0.00
crit 10.2 33.87% 260836.20 165972 322658 260806.46 0 297462 2662730 2662730 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 34270 11.5% 18.0 23.45sec 858586 0 Periodic 140.5 82221 164507 109908 33.7% 40.2%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.98 0.00 140.46 140.46 0.0000 1.2873 15438407.51 15438407.51 0.00 85382.81 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.2 66.35% 82221.03 57 97721 82127.36 70543 88867 7662410 7662410 0.00
crit 47.3 33.65% 164506.66 114 195442 164369.93 141552 184775 7775997 7775997 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 26689 8.9% 493.3 0.91sec 24338 26758 Direct 493.3 18193 36384 24338 33.8%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 493.29 493.29 0.00 0.00 0.9096 0.0000 12005728.70 17649558.40 31.98 26757.65 26757.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 326.64 66.22% 18192.54 14216 20436 18192.52 17696 18481 5942291 8735730 31.98
crit 166.65 33.78% 36383.98 28433 40872 36383.35 35321 37234 6063438 8913828 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 5657 1.9% 9.9 48.30sec 257421 256283 Direct 9.9 183150 403075 257432 33.8%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.87 9.87 0.00 0.00 1.0045 0.0000 2541555.88 3736327.88 31.98 256282.73 256282.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.54 66.22% 183150.16 14753 251221 182581.29 36263 243029 1197298 1760141 31.98
crit 3.34 33.78% 403074.79 32720 555198 393068.93 0 555198 1344258 1976186 31.24
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Horrific Slam 6717 2.2% 95.8 3.69sec 31546 0 Direct 95.8 23563 47089 31545 33.9%  

Stats details: horrific_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.83 95.83 0.00 0.00 0.0000 0.0000 3023218.77 3023218.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.31 66.07% 23562.86 18381 26423 23564.83 21029 25561 1491837 1491837 0.00
crit 32.52 33.93% 47089.43 36763 52846 47095.83 41971 51554 1531381 1531381 0.00
 
 

Action details: horrific_slam

Static Values
  • id:222168
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222168
  • name:Horrific Slam
  • school:physical
  • tooltip:
  • description:{$@spelldesc222167=Your melee attacks have a chance to generate extra appendages for {$222166d=12 seconds} that attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$222166t1}.2 sec.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16532.30
  • base_dd_max:18272.54
 
Moonfire (lunar_inspiration) 21395 7.1% 31.5 14.36sec 305091 303722 Direct 31.5 32954 65929 44152 34.0%  
Periodic 242.0 25445 50880 34013 33.7% 96.7%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.54 31.54 241.98 241.98 1.0045 1.7976 9623120.65 9623120.65 0.00 20621.40 303721.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.83 66.04% 32953.59 25727 36982 32953.43 30856 35053 686457 686457 0.00
crit 10.71 33.96% 65928.87 51454 73964 65926.05 58069 73964 706158 706158 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 160.5 66.31% 25445.00 134 28764 25445.19 24520 26073 4083069 4083069 0.00
crit 81.5 33.69% 50879.86 268 57529 50878.69 48319 52980 4147437 4147437 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2122 0.7% 23.5 18.74sec 40653 0 Periodic 69.5 13747 0 13747 0.0% 7.7%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.50 0.00 69.50 69.50 0.0000 0.4974 955376.52 1404493.97 31.98 27640.80 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.5 100.00% 13747.21 31 15493 13750.94 12664 14685 955377 1404494 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 10873 3.6% 23.0 17.54sec 209764 0 Direct 23.0 156502 312790 209766 34.1%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.00 23.00 0.00 0.00 0.0000 0.0000 4825588.10 7094071.60 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.17 65.92% 156502.35 122075 175482 156487.22 142251 167159 2373404 3489129 31.98
crit 7.84 34.08% 312789.61 244149 350964 312738.88 259408 350964 2452184 3604942 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 67926 22.7% 46.9 9.64sec 651489 648573 Direct 46.9 84208 168530 112665 33.7%  
Periodic 223.5 84516 169047 113071 33.8% 94.5%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.90 46.90 223.49 223.49 1.0045 1.9032 30554269.58 30554269.58 0.00 64670.73 648572.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.07 66.25% 84208.45 39701 189864 84194.08 71595 94463 2616494 2616494 0.00
crit 15.83 33.75% 168530.32 79402 379727 168480.87 124632 212696 2667363 2667363 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.0 66.21% 84515.79 37 189864 84540.19 74620 94544 12506828 12506828 0.00
crit 75.5 33.79% 169047.17 82 379727 169125.10 141984 195684 12763585 12763585 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 81548 27.3% 22.6 15.78sec 1621412 1614186 Periodic 325.0 84450 168976 112959 33.7% 95.5%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.64 0.00 324.98 324.98 1.0045 1.3225 36709822.70 36709822.70 0.00 81121.30 1614186.21
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 215.4 66.27% 84450.14 63 97721 84438.36 78134 88523 18188641 18188641 0.00
crit 109.6 33.73% 168975.94 114 195442 168936.31 153923 178280 18521181 18521181 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 27783 9.3% 105.6 4.26sec 118279 117749 Direct 105.6 88401 176846 118283 33.8%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.57 105.57 0.00 0.00 1.0045 0.0000 12487068.40 18357173.36 31.98 117749.21 117749.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.91 66.22% 88401.08 61977 133637 88420.05 83509 94048 6179774 9084853 31.98
crit 35.67 33.78% 176846.01 123954 267275 176772.73 160123 198971 6307295 9272320 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
spontaneous_appendages_865
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:spontaneous_appendages_865
  • harmful:false
  • if_expr:
 
Berserk 3.0 182.06sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:spontaneous_appendages_865
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:spontaneous_appendages_865
  • harmful:false
  • if_expr:
 
Healing Touch 48.9 9.32sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 48.91 0.00 0.00 0.00 0.8984 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.3 25.07sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.33 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.63sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.35sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.12% 10.19% 45.5(45.5) 15.1

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 182.0sec 182.0sec 9.79% 15.28% 0.0(0.0) 2.9

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 48.9 0.0 9.3sec 9.3sec 45.64% 45.68% 0.0(0.0) 0.0

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:19.21%
  • bloodtalons_2:26.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 42.0 1.1 10.5sec 10.3sec 5.95% 15.04% 1.1(1.1) 0.0

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:5.95%

Trigger Attempt Success

  • trigger_pct:8.73%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Horrific Appendages 5.5 0.9 74.8sec 62.5sec 16.16% 16.25% 96.7(96.7) 5.3

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_horrific_appendages
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • horrific_appendages_1:16.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:222166
  • name:Horrific Appendages
  • tooltip:Your extra appendages attack nearby enemies for {$222168s1=9904 to 10947} Physical damage every ${$t1}.2 sec.
  • description:
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Jacin's Ruse 6.6 1.8 63.7sec 48.5sec 24.64% 24.73% 1.8(1.8) 6.4

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.3sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 48.6 1.3 9.2sec 9.0sec 74.43% 74.44% 1.3(1.3) 0.0

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.43%

Trigger Attempt Success

  • trigger_pct:98.17%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.9 9.4 45.2sec 25.0sec 92.36% 92.11% 200.9(200.9) 7.9

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:92.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.7sec 133.7sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.82% 29.27% 0.0(0.0) 14.9

Buff details

  • buff initial source:spontaneous_appendages_865
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
spontaneous_appendages_865
ferocious_bite Energy 19.7 329.5 16.7 33.4 7712.9
ferocious_bite Combo Points 9.9 44.7 4.5 4.5 56844.6
lunar_inspiration Energy 31.5 784.2 24.9 24.9 12270.6
rake Energy 46.9 1335.1 28.5 28.5 22886.1
rip Energy 22.6 464.5 20.5 20.5 79026.3
rip Combo Points 22.6 113.2 5.0 5.0 324270.4
savage_roar Energy 18.3 479.7 26.2 26.2 0.0
savage_roar Combo Points 18.3 91.6 5.0 5.0 0.0
shred Energy 105.6 3110.9 29.5 29.5 4014.0
Resource Gains Type Count Total Average Overflow
rake Combo Points 46.90 46.90 (18.56%) 1.00 0.00 0.00%
tigers_fury Energy 15.22 912.52 (11.56%) 59.97 0.45 0.05%
ashamanes_frenzy Combo Points 6.10 18.30 (7.24%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.54 31.54 (12.48%) 1.00 0.00 0.00%
shred Combo Points 105.57 105.57 (41.78%) 1.00 0.00 0.00%
energy_regen Energy 2043.63 4880.87 (61.85%) 2.39 59.89 1.21%
clearcasting Energy 41.88 1433.50 (18.17%) 34.23 0.00 0.00%
ashamanes_energy Energy 45.46 664.47 (8.42%) 14.62 17.49 2.56%
primal_fury Combo Points 62.21 50.40 (19.94%) 0.81 11.81 18.98%
Resource RPS-Gain RPS-Loss
Energy 14.35 14.45
Combo Points 0.56 0.55
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 34.69 0.01 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.21 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.7%

Procs

Count Interval
clearcasting 43.1 10.3sec
clearcasting_wasted 1.1 122.1sec
primal_fury 62.2 7.2sec

Statistics & Data Analysis

Fight Length
Sample Data spontaneous_appendages_865 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data spontaneous_appendages_865 Damage Per Second
Count 2499
Mean 299360.75
Minimum 267619.57
Maximum 333074.92
Spread ( max - min ) 65455.35
Range [ ( max - min ) / 2 * 100% ] 10.93%
Standard Deviation 9917.8304
5th Percentile 283341.53
95th Percentile 315476.97
( 95th Percentile - 5th Percentile ) 32135.44
Mean Distribution
Standard Deviation 198.3963
95.00% Confidence Intervall ( 298971.90 - 299749.60 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4216
0.1 Scale Factor Error with Delta=300 839686
0.05 Scale Factor Error with Delta=300 3358744
0.01 Scale Factor Error with Delta=300 83968621
Priority Target DPS
Sample Data spontaneous_appendages_865 Priority Target Damage Per Second
Count 2499
Mean 299360.75
Minimum 267619.57
Maximum 333074.92
Spread ( max - min ) 65455.35
Range [ ( max - min ) / 2 * 100% ] 10.93%
Standard Deviation 9917.8304
5th Percentile 283341.53
95th Percentile 315476.97
( 95th Percentile - 5th Percentile ) 32135.44
Mean Distribution
Standard Deviation 198.3963
95.00% Confidence Intervall ( 298971.90 - 299749.60 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4216
0.1 Scale Factor Error with Delta=300 839686
0.05 Scale Factor Error with Delta=300 3358744
0.01 Scale Factor Error with Delta=300 83968621
DPS(e)
Sample Data spontaneous_appendages_865 Damage Per Second (Effective)
Count 2499
Mean 299360.75
Minimum 267619.57
Maximum 333074.92
Spread ( max - min ) 65455.35
Range [ ( max - min ) / 2 * 100% ] 10.93%
Damage
Sample Data spontaneous_appendages_865 Damage
Count 2499
Mean 134635189.68
Minimum 98799383.04
Maximum 171991228.89
Spread ( max - min ) 73191845.85
Range [ ( max - min ) / 2 * 100% ] 27.18%
DTPS
Sample Data spontaneous_appendages_865 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data spontaneous_appendages_865 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data spontaneous_appendages_865 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data spontaneous_appendages_865 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data spontaneous_appendages_865 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data spontaneous_appendages_865 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data spontaneous_appendages_865Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data spontaneous_appendages_865 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.55 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.55 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.22 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 4.25 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 47.91 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.90 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.64 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 9.43 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 5.62 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.10 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.55 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.34 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.54 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 105.57 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQQICAQEMJQQOELPOQEJQQQQEKOPQEJOQQCQEJN89PQEKQQQQEJOPQEOJCQPQQEJOQQQEIMOPEJOQQCQEJOPQQEIOPOQEJQQPCQEJOQQQQEIOPOQEQJPCQEMJOQQQPEIOOQEOJCAPQQQEJN89QQQEIPQQQEJOQQEKOPCQQEJOQQPEJMOQEKOPCQQQEJOQQPEJOQQPQEICOQQQQEJOPQEOPIOCQQQEJMPEKOOPEQJQQCOQEJN89PQQEIODPEOQCABQKQQQELOPQELQQQELMOEKOPQCELQQQPOEKODPQQELCOQQQPEKOQ

Sample Sequence Table

time name target resources buffs
Pre flask spontaneous_appendages_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food spontaneous_appendages_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation spontaneous_appendages_865 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 60.0/100: 60% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:03.014 shred Fluffy_Pillow 33.9/100: 34% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, clearcasting, potion_of_the_old_war
0:04.018 savage_roar Fluffy_Pillow 47.9/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, potion_of_the_old_war
0:05.024 tigers_fury Fluffy_Pillow 21.9/100: 22% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:05.024 berserk Fluffy_Pillow 81.9/100: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:05.024 shred Fluffy_Pillow 81.9/150: 55% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:06.027 healing_touch Fluffy_Pillow 90.8/150: 61% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:06.780 ashamanes_frenzy Fluffy_Pillow 101.3/150: 68% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:07.786 rip Fluffy_Pillow 130.3/150: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:08.791 shred Fluffy_Pillow 144.3/150: 96% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:09.796 shred Fluffy_Pillow 138.3/150: 92% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:10.800 rake Fluffy_Pillow 132.2/150: 88% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:11.803 healing_touch Fluffy_Pillow 128.7/150: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
0:12.556 ferocious_bite Fluffy_Pillow 139.2/150: 93% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, horrific_appendages, potion_of_the_old_war
0:13.561 lunar_inspiration Fluffy_Pillow 128.1/150: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
0:14.566 rake Fluffy_Pillow 127.1/150: 85% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
0:15.570 shred Fluffy_Pillow 123.6/150: 82% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
0:16.574 healing_touch Fluffy_Pillow 117.6/150: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse, potion_of_the_old_war
0:17.329 rip Fluffy_Pillow 128.1/150: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, horrific_appendages, jacins_ruse, potion_of_the_old_war
0:18.333 shred Fluffy_Pillow 127.0/150: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse, potion_of_the_old_war
0:19.337 shred Fluffy_Pillow 121.0/150: 81% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse, potion_of_the_old_war
0:20.342 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse, potion_of_the_old_war
0:21.346 shred Fluffy_Pillow 74.0/100: 74% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse, potion_of_the_old_war
0:22.352 healing_touch Fluffy_Pillow 48.0/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse, potion_of_the_old_war
0:23.105 Waiting 0.200 sec 58.4/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
0:23.305 savage_roar Fluffy_Pillow 61.2/100: 61% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
0:24.310 rake Fluffy_Pillow 75.2/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
0:25.314 lunar_inspiration Fluffy_Pillow 54.2/100: 54% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:26.316 Waiting 0.200 sec 38.1/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:26.516 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:27.522 healing_touch Fluffy_Pillow 14.9/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, jacins_ruse
0:28.278 Waiting 3.800 sec 25.4/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, jacins_ruse
0:32.078 rip Fluffy_Pillow 78.3/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:33.083 rake Fluffy_Pillow 62.2/100: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:34.087 shred Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:35.092 shred Fluffy_Pillow 55.2/100: 55% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar
0:36.095 tigers_fury Fluffy_Pillow 29.1/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar
0:36.095 shred Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:37.099 healing_touch Fluffy_Pillow 78.1/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:37.853 rip Fluffy_Pillow 88.6/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:38.857 shadowmeld Fluffy_Pillow 87.6/100: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:38.857 rake Fluffy_Pillow 87.6/100: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:38.857 auto_attack Fluffy_Pillow 52.6/100: 53% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:39.861 lunar_inspiration Fluffy_Pillow 81.5/100: 82% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:40.867 shred Fluffy_Pillow 65.5/100: 66% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:41.871 healing_touch Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
0:42.811 Waiting 2.500 sec 46.3/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
0:45.311 savage_roar Fluffy_Pillow 73.1/100: 73% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
0:46.316 shred Fluffy_Pillow 83.8/100: 84% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
0:47.320 shred Fluffy_Pillow 54.6/100: 55% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:48.323 shred Fluffy_Pillow 25.3/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
0:49.327 Waiting 0.400 sec 36.0/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:49.727 shred Fluffy_Pillow 40.3/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:50.730 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:51.667 rip Fluffy_Pillow 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
0:53.181 rake Fluffy_Pillow 37.3/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
0:54.185 Waiting 1.618 sec 13.0/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:55.803 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:56.808 Waiting 2.799 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
0:59.607 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:00.613 Waiting 1.632 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:02.245 healing_touch Fluffy_Pillow 29.3/100: 29% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:03.182 rake Fluffy_Pillow 39.3/100: 39% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
1:04.188 Waiting 1.428 sec 15.1/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
1:05.616 rip Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
1:06.620 tigers_fury Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
1:06.620 shred Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:07.626 lunar_inspiration Fluffy_Pillow 56.9/100: 57% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:08.631 shred Fluffy_Pillow 52.6/100: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:09.637 Waiting 0.200 sec 38.4/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
1:09.837 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
1:10.841 healing_touch Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:11.781 Waiting 0.844 sec 21.3/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:12.625 rip Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:15.671 rake Fluffy_Pillow 32.9/100: 33% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
1:16.675 shred Fluffy_Pillow 43.7/100: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness
1:17.679 shred Fluffy_Pillow 14.4/100: 14% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness
1:18.682 Waiting 1.400 sec 25.2/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:20.082 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
1:21.086 healing_touch Fluffy_Pillow 10.9/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
1:23.809 savage_roar Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
1:24.813 ashamanes_frenzy Fluffy_Pillow 10.8/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:27.093 rake Fluffy_Pillow 35.2/100: 35% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
1:28.097 Waiting 1.816 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:29.913 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:30.918 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:31.854 Waiting 0.963 sec 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:32.817 rip Fluffy_Pillow 31.4/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:33.824 rake Fluffy_Pillow 42.2/100: 42% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:34.829 Waiting 1.359 sec 17.9/100: 18% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:36.188 shred Fluffy_Pillow 32.5/100: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
1:37.192 shred Fluffy_Pillow 43.2/100: 43% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:38.195 tigers_fury Fluffy_Pillow 14.0/100: 14% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:38.195 shred Fluffy_Pillow 74.0/100: 74% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:39.199 healing_touch Fluffy_Pillow 59.7/100: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:40.139 Waiting 0.500 sec 69.8/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:40.639 rip Fluffy_Pillow 90.1/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:41.646 rake Fluffy_Pillow 85.9/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:42.651 lunar_inspiration Fluffy_Pillow 61.6/100: 62% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
1:43.653 shred Fluffy_Pillow 42.4/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:44.655 Waiting 2.613 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:47.268 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:48.271 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness
1:49.212 savage_roar Fluffy_Pillow 21.9/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
1:50.472 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:51.476 Waiting 2.300 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:53.776 lunar_inspiration Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:54.780 Waiting 1.800 sec 16.4/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:56.580 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:57.584 Waiting 1.267 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:58.851 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
1:59.856 healing_touch Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:00.795 Waiting 0.800 sec 45.8/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:01.595 rip Fluffy_Pillow 54.4/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
2:02.602 shred Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
2:03.606 Waiting 0.400 sec 35.9/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:04.006 shred Fluffy_Pillow 40.2/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:05.013 Waiting 2.714 sec 10.9/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:07.727 lunar_inspiration Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:08.732 tigers_fury Fluffy_Pillow 20.7/100: 21% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:08.732 shred Fluffy_Pillow 80.7/100: 81% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:09.735 healing_touch Fluffy_Pillow 66.5/100: 66% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:10.674 rip Fluffy_Pillow 76.5/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:11.678 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
2:12.683 shred Fluffy_Pillow 90.8/100: 91% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
2:13.686 shred Fluffy_Pillow 61.5/100: 61% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
2:14.691 Waiting 0.800 sec 32.2/100: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
2:15.491 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
2:16.496 Waiting 2.756 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
2:19.252 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
2:20.257 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness
2:21.196 savage_roar Fluffy_Pillow 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
2:22.457 rake Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages
2:23.460 Waiting 1.801 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
2:25.261 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
2:28.568 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
2:29.573 shred Fluffy_Pillow 11.5/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, horrific_appendages
2:30.576 Waiting 1.159 sec 22.2/100: 22% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:31.735 healing_touch Fluffy_Pillow 34.6/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
2:32.673 shred Fluffy_Pillow 44.7/100: 45% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
2:33.678 Waiting 1.395 sec 15.4/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, horrific_appendages, jacins_ruse
2:35.073 rip Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, jacins_ruse
2:36.078 Waiting 1.799 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:37.877 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:38.880 tigers_fury Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
2:38.880 shred Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:39.885 healing_touch Fluffy_Pillow 96.8/100: 97% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:40.822 ashamanes_frenzy Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
2:41.828 rip Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
2:42.832 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:43.834 shred Fluffy_Pillow 75.7/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:44.838 shred Fluffy_Pillow 46.5/100: 46% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:45.843 Waiting 2.227 sec 17.2/100: 17% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury, jacins_ruse
2:48.070 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
2:49.076 Waiting 1.732 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
2:50.808 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
2:51.811 healing_touch Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness
2:52.749 savage_roar Fluffy_Pillow 21.1/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
2:54.267 rake Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:55.272 Waiting 2.110 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:57.382 rake Fluffy_Pillow 35.7/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
2:58.386 Waiting 2.767 sec 11.4/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:01.153 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:02.156 Waiting 1.235 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
3:03.391 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, horrific_appendages
3:04.330 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar, horrific_appendages
3:05.333 Waiting 1.829 sec 10.8/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, horrific_appendages
3:07.162 rip Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, horrific_appendages
3:08.166 Waiting 1.299 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, horrific_appendages
3:09.465 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, horrific_appendages
3:09.465 berserk Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:09.465 lunar_inspiration Fluffy_Pillow 85.0/150: 57% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:10.468 shred Fluffy_Pillow 95.7/150: 64% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:11.473 shred Fluffy_Pillow 101.5/150: 68% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:12.477 shred Fluffy_Pillow 107.2/150: 71% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:13.482 healing_touch Fluffy_Pillow 98.0/150: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:14.420 rip Fluffy_Pillow 108.0/150: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury
3:15.425 shadowmeld Fluffy_Pillow 103.8/150: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury
3:15.425 rake Fluffy_Pillow 103.8/150: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury
3:15.425 auto_attack Fluffy_Pillow 86.3/150: 58% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:16.429 shred Fluffy_Pillow 97.0/150: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:17.434 shred Fluffy_Pillow 87.8/150: 59% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, tigers_fury
3:18.438 shred Fluffy_Pillow 78.5/150: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness
3:19.444 healing_touch Fluffy_Pillow 69.3/150: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness
3:20.382 savage_roar Fluffy_Pillow 79.3/150: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk
3:21.385 lunar_inspiration Fluffy_Pillow 70.0/150: 47% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar
3:22.390 shred Fluffy_Pillow 65.8/150: 44% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar
3:23.393 shred Fluffy_Pillow 56.5/150: 38% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:24.398 shred Fluffy_Pillow 47.3/150: 32% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar
3:25.405 healing_touch Fluffy_Pillow 38.1/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
3:26.344 Waiting 1.000 sec 48.1/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:27.344 rip Fluffy_Pillow 58.8/100: 59% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:28.348 rake Fluffy_Pillow 69.5/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
3:29.352 shred Fluffy_Pillow 80.3/100: 80% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
3:30.356 shred Fluffy_Pillow 51.0/100: 51% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:31.361 healing_touch Fluffy_Pillow 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:32.300 Waiting 4.200 sec 31.8/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:36.500 savage_roar Fluffy_Pillow 76.8/100: 77% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:37.505 rake Fluffy_Pillow 47.5/100: 48% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages
3:38.509 Waiting 0.660 sec 23.3/100: 23% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
3:39.169 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
3:40.172 tigers_fury Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
3:40.172 shred Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:41.176 shred Fluffy_Pillow 56.8/100: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:42.179 healing_touch Fluffy_Pillow 42.5/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:43.117 Waiting 2.100 sec 52.6/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, horrific_appendages
3:45.217 rip Fluffy_Pillow 90.1/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, horrific_appendages
3:46.221 rake Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:47.223 shred Fluffy_Pillow 46.5/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages
3:48.229 shred Fluffy_Pillow 57.3/100: 57% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages
3:49.234 Waiting 0.200 sec 28.0/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:49.434 lunar_inspiration Fluffy_Pillow 30.2/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:50.438 healing_touch Fluffy_Pillow 10.9/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:51.377 Waiting 5.676 sec 21.0/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:57.053 rip Fluffy_Pillow 81.7/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:58.058 ashamanes_frenzy Fluffy_Pillow 62.5/100: 62% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:59.062 rake Fluffy_Pillow 73.2/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:00.065 shred Fluffy_Pillow 48.9/100: 49% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:01.070 healing_touch Fluffy_Pillow 19.7/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:02.010 Waiting 5.200 sec 29.8/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:07.210 savage_roar Fluffy_Pillow 85.4/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:08.216 rake Fluffy_Pillow 56.2/100: 56% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:09.219 lunar_inspiration Fluffy_Pillow 31.9/100: 32% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:10.224 tigers_fury Fluffy_Pillow 12.6/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:10.224 shred Fluffy_Pillow 72.6/100: 73% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:11.229 shred Fluffy_Pillow 98.4/100: 98% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:12.232 shred Fluffy_Pillow 84.1/100: 84% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:13.239 healing_touch Fluffy_Pillow 69.9/100: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:14.177 Waiting 0.900 sec 79.9/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:15.077 rip Fluffy_Pillow 89.6/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:16.081 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:17.088 shred Fluffy_Pillow 46.1/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
4:18.092 shred Fluffy_Pillow 56.8/100: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
4:19.096 Waiting 0.300 sec 27.6/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:19.396 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:20.400 healing_touch Fluffy_Pillow 11.5/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
4:21.340 Waiting 6.318 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:27.658 rip Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages
4:28.662 rake Fluffy_Pillow 69.9/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages
4:29.666 shred Fluffy_Pillow 45.7/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, horrific_appendages
4:30.671 Waiting 2.299 sec 16.4/100: 16% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, horrific_appendages
4:32.970 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, horrific_appendages
4:33.974 Waiting 1.734 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, horrific_appendages
4:35.708 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, horrific_appendages
4:36.712 shred Fluffy_Pillow 11.1/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, horrific_appendages
4:37.717 healing_touch Fluffy_Pillow 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:39.423 savage_roar Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
4:40.426 tigers_fury Fluffy_Pillow 10.8/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:40.426 rake Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:41.430 shred Fluffy_Pillow 61.6/100: 62% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:42.435 shred Fluffy_Pillow 47.3/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:43.440 Waiting 0.700 sec 33.1/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:44.140 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:45.145 shred Fluffy_Pillow 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
4:46.150 healing_touch Fluffy_Pillow 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:47.089 Waiting 1.500 sec 32.1/100: 32% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:48.589 rip Fluffy_Pillow 48.2/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
4:50.359 rake Fluffy_Pillow 37.1/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
4:51.363 Waiting 1.634 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:52.997 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:54.002 Waiting 2.799 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:56.801 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:57.804 Waiting 1.335 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
4:59.139 healing_touch Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:00.078 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar
5:01.082 Waiting 1.727 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar
5:02.809 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, savage_roar
5:06.627 savage_roar Fluffy_Pillow 41.2/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons
5:09.930 rake Fluffy_Pillow 36.5/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:10.934 tigers_fury Fluffy_Pillow 12.3/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
5:10.934 shred Fluffy_Pillow 72.3/100: 72% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:11.938 shred Fluffy_Pillow 58.0/100: 58% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:12.941 shred Fluffy_Pillow 43.8/100: 44% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:13.944 healing_touch Fluffy_Pillow 29.5/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:14.883 rip Fluffy_Pillow 39.5/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:15.888 ashamanes_frenzy Fluffy_Pillow 20.3/100: 20% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:16.892 lunar_inspiration Fluffy_Pillow 31.0/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:17.897 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:18.836 Waiting 1.795 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:20.631 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:23.937 rake Fluffy_Pillow 36.4/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:24.941 Waiting 2.099 sec 12.2/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:27.296 rake Fluffy_Pillow 37.4/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:28.300 Waiting 2.511 sec 13.1/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:30.811 lunar_inspiration Fluffy_Pillow 40.0/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:31.817 healing_touch Fluffy_Pillow 20.7/100: 21% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
5:32.757 shred Fluffy_Pillow 30.8/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
5:33.762 rip Fluffy_Pillow 41.6/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, jacins_ruse
5:34.766 Waiting 1.752 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:36.518 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:37.523 Waiting 2.733 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:40.256 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:41.260 tigers_fury Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:41.260 rake Fluffy_Pillow 71.8/100: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:42.263 shred Fluffy_Pillow 62.5/100: 63% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:43.267 healing_touch Fluffy_Pillow 48.3/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:44.205 Waiting 1.500 sec 58.3/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
5:45.705 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:46.709 shadowmeld Fluffy_Pillow 70.1/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:46.709 rake Fluffy_Pillow 70.1/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:46.709 auto_attack Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
5:47.714 lunar_inspiration Fluffy_Pillow 45.9/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
5:48.719 Waiting 1.300 sec 26.6/100: 27% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
5:50.019 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:51.023 Waiting 2.784 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:53.807 shred Fluffy_Pillow 41.1/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
5:54.811 healing_touch Fluffy_Pillow 11.8/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
5:57.536 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
5:58.542 Waiting 1.241 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:00.807 rake Fluffy_Pillow 36.0/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:01.812 Waiting 1.342 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
6:03.154 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
6:04.158 Waiting 1.832 sec 10.7/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
6:05.990 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
6:06.995 Waiting 1.298 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:08.293 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar
6:09.232 rake Fluffy_Pillow 35.0/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons(2), savage_roar
6:10.237 shred Fluffy_Pillow 45.8/100: 46% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, savage_roar
6:11.241 tigers_fury Fluffy_Pillow 16.5/100: 17% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points savage_roar
6:11.260 berserk Fluffy_Pillow 76.7/100: 77% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, savage_roar, tigers_fury
6:11.260 potion Fluffy_Pillow 76.7/150: 51% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, savage_roar, tigers_fury
6:11.260 shred Fluffy_Pillow 76.7/150: 51% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:12.264 savage_roar Fluffy_Pillow 82.5/150: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:13.267 shred Fluffy_Pillow 88.2/150: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:14.269 shred Fluffy_Pillow 93.9/150: 63% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:15.274 shred Fluffy_Pillow 84.7/150: 56% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:16.277 healing_touch Fluffy_Pillow 75.4/150: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:17.215 ferocious_bite Fluffy_Pillow 85.5/150: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:18.218 rake Fluffy_Pillow 71.2/150: 47% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:19.223 lunar_inspiration Fluffy_Pillow 64.4/150: 43% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:20.227 shred Fluffy_Pillow 60.2/150: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:21.231 healing_touch Fluffy_Pillow 70.9/150: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:22.172 ferocious_bite Fluffy_Pillow 81.0/150: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:23.175 shred Fluffy_Pillow 66.7/150: 44% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:24.179 shred Fluffy_Pillow 57.5/150: 38% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:25.184 shred Fluffy_Pillow 48.2/150: 32% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:26.190 healing_touch Fluffy_Pillow 39.0/150: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:27.128 Waiting 3.800 sec 49.0/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, potion_of_the_old_war
6:30.928 ferocious_bite Fluffy_Pillow 89.7/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, potion_of_the_old_war
6:31.932 ashamanes_frenzy Fluffy_Pillow 50.4/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:32.938 rake Fluffy_Pillow 61.2/100: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:33.944 healing_touch Fluffy_Pillow 37.0/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, horrific_appendages, potion_of_the_old_war
6:34.883 Waiting 3.300 sec 47.0/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, potion_of_the_old_war
6:38.183 savage_roar Fluffy_Pillow 82.3/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, horrific_appendages
6:39.188 rake Fluffy_Pillow 93.1/100: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:40.193 lunar_inspiration Fluffy_Pillow 68.8/100: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
6:41.197 shred Fluffy_Pillow 49.6/100: 50% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar
6:42.201 tigers_fury Fluffy_Pillow 20.3/100: 20% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:42.201 healing_touch Fluffy_Pillow 80.3/100: 80% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:43.139 ferocious_bite Fluffy_Pillow 90.4/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
6:44.143 shred Fluffy_Pillow 66.1/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:45.149 shred Fluffy_Pillow 51.9/100: 52% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:46.153 Waiting 0.300 sec 37.6/100: 38% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
6:46.453 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
6:47.456 Waiting 2.556 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
6:50.012 lunar_inspiration Fluffy_Pillow 38.9/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
6:51.015 Waiting 1.300 sec 19.6/100: 20% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:52.570 rake Fluffy_Pillow 36.3/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
6:53.574 healing_touch Fluffy_Pillow 12.0/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:54.512 Waiting 6.374 sec 22.1/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:00.886 savage_roar Fluffy_Pillow 90.3/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:01.890 rake Fluffy_Pillow 61.0/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:02.895 ferocious_bite Fluffy_Pillow 36.8/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
7:03.899 Waiting 0.732 sec 22.5/100: 23% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:04.631 lunar_inspiration Fluffy_Pillow 30.3/100: 30% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:05.635 Waiting 2.800 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:08.435 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:09.440 Waiting 1.333 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
7:10.773 shred Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
7:11.779 healing_touch Fluffy_Pillow 36.8/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
7:12.719 Waiting 0.300 sec 46.9/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:13.019 ferocious_bite Fluffy_Pillow 50.1/100: 50% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
7:14.023 tigers_fury Fluffy_Pillow 10.8/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
7:14.023 rake Fluffy_Pillow 70.8/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
7:15.028 shred Fluffy_Pillow 61.6/100: 62% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
7:16.030 shred Fluffy_Pillow 47.3/100: 47% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
7:17.035 Waiting 0.700 sec 33.1/100: 33% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
7:17.735 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
7:18.738 Waiting 1.380 sec 11.3/100: 11% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
7:20.118 lunar_inspiration Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
7:21.124 healing_touch Fluffy_Pillow 36.8/100: 37% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, horrific_appendages, jacins_ruse
7:22.062 Waiting 0.600 sec 46.9/100: 47% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
7:22.662 savage_roar Fluffy_Pillow 53.3/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, horrific_appendages, jacins_ruse
7:24.941 rake Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, horrific_appendages, jacins_ruse
7:25.945 Waiting 2.582 sec 13.4/100: 13% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
7:28.527 shred Fluffy_Pillow 41.0/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
7:29.534 Waiting 1.231 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 33.77% 33.77% 6220
Haste 7.01% 7.01% 2277
Damage / Heal Versatility 5.63% 5.63% 2251
Attack Power 21649 19943 0
Mastery 57.32% 55.18% 6857
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 846.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Spontaneous Appendages
ilevel: 865, stats: { +986 Mastery }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="spontaneous_appendages_865"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=spontaneous_appendages,id=139325,bonus_id=1805,ilevel=865
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=845.67
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=6220
# gear_haste_rating=1518
# gear_mastery_rating=6857
# gear_versatility_rating=2251
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

unstable_arcanocrystal_860 : 308647 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
308646.8 308646.8 395.9 / 0.128% 39718.0 / 12.9% 20842.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.8 14.8 Energy 30.70% 43.0 100.0% 100%
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Guardian Affinity (Feral Druid)
  • 60: Typhoon
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
unstable_arcanocrystal_860 308647
Ashamane's Frenzy 14813 4.8% 6.1 78.52sec 1090606 1085885 Direct 91.4 9979 19956 13565 35.9%  
Periodic 30.2 131968 264072 179678 36.1% 17.5%

Stats details: ashamanes_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.11 91.36 121.54 30.18 1.0045 0.6469 6661902.30 7244457.31 8.04 78589.83 1085884.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.53 64.07% 9978.60 7435 11859 9980.68 9071 10942 584081 858654 31.98
crit 32.83 35.93% 19956.11 14870 23719 19958.38 17830 22084 655148 963130 31.98
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.3 63.88% 131967.53 81974 163449 131992.45 117109 149319 2544248 2544248 0.00
crit 10.9 36.12% 264072.36 163948 326898 264108.73 218665 311444 2878425 2878425 0.00
 
 

Action details: ashamanes_frenzy

Static Values
  • id:210722
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:75.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
Spelldata
  • id:210722
  • name:Ashamane's Frenzy
  • school:physical
  • tooltip:
  • description:Unleash Ashamane's Frenzy, clawing your target $m2 times over {$d=3 seconds} for ${{$210723s1=1}*$m2} Physical damage and an additional ${{$210723s3=1}*3*$m2} Bleed damage over {$210723d=6 seconds}. |cFFFFFFFFAwards {$s3=3} combo $Lpoint:points;.|r
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Ashamane's Rip 36585 11.9% 18.4 23.26sec 894588 0 Periodic 144.9 83529 166968 113579 36.0% 41.5%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.40 0.00 144.91 144.91 0.0000 1.2888 16458779.05 16458779.05 0.00 88130.80 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.7 63.99% 83529.44 58 99005 83467.91 72731 91046 7745042 7745042 0.00
crit 52.2 36.01% 166967.53 116 198011 166803.63 143814 184644 8713737 8713737 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 28694 9.3% 510.3 0.88sec 25293 28763 Direct 510.3 18589 37181 25293 36.1%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 510.33 510.33 0.00 0.00 0.8793 0.0000 12907637.22 18975449.36 31.98 28763.28 28763.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 326.32 63.94% 18588.88 14488 20826 18588.36 18203 18874 6065883 8917423 31.98
crit 184.01 36.06% 37180.96 28976 41653 37180.73 36315 37913 6841754 10058027 31.98
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 6704 2.2% 10.7 43.81sec 280819 279572 Direct 10.7 194691 431487 280805 36.4%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.74 10.74 0.00 0.00 1.0045 0.0000 3014620.66 4431777.92 31.98 279571.61 279571.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.83 63.63% 194691.43 15139 256019 194324.12 87604 256019 1329709 1954798 31.98
crit 3.90 36.37% 431486.57 34240 565803 427337.20 0 565803 1684912 2476980 31.77
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s1079[When used on targets below 25% health, ][]{$?s1079=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 22934 7.4% 31.6 14.35sec 326477 325023 Direct 31.6 33652 67266 45783 36.1%  
Periodic 252.0 25883 51777 35202 36.0% 96.8%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.60 31.60 252.00 252.00 1.0045 1.7294 10316893.55 10316893.55 0.00 22066.19 325023.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.20 63.92% 33651.64 26218 37689 33648.01 31638 35582 679738 679738 0.00
crit 11.40 36.08% 67266.07 52436 75377 67247.62 59646 72919 766907 766907 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 161.3 64.02% 25882.54 158 29314 25882.06 24937 26583 4175212 4175212 0.00
crit 90.7 35.98% 51776.81 316 58627 51778.05 49386 53721 4695037 4695037 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Mark of the Distant Army 2246 0.7% 24.3 18.27sec 41526 0 Periodic 72.0 14043 0 14043 0.0% 7.9%

Stats details: mark_of_the_distant_army

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.33 0.00 71.96 71.96 0.0000 0.4971 1010526.06 1485569.02 31.98 28249.08 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.0 100.00% 14043.02 27 15789 14044.37 13146 14885 1010526 1485569 31.98
 
 

Action details: mark_of_the_distant_army

Static Values
  • id:191380
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191380
  • name:Mark of the Distant Army
  • school:physical
  • tooltip:Under fire, taking {$s1=13875 to 16125} damage every $t sec.
  • description:A distant army fires a volley of arrows, dealing $o1 damage over {$d=1.500 seconds}.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:15000.00
  • dot_duration:1.50
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11623 3.7% 23.8 16.86sec 217278 0 Direct 23.8 159741 319589 217261 36.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.76 23.76 0.00 0.00 0.0000 0.0000 5162587.26 7589492.28 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.21 64.01% 159740.83 124406 178834 159711.22 145612 171281 2429311 3571317 31.98
crit 8.55 35.99% 319589.07 248812 357668 319555.40 279914 349892 2733277 4018176 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 70594 22.9% 47.3 9.53sec 671468 668474 Direct 47.3 85535 171559 116583 36.1%  
Periodic 223.6 86258 172372 117396 36.2% 94.9%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.30 47.30 223.55 223.55 1.0045 1.9098 31759186.38 31759186.38 0.00 66938.53 668473.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.23 63.91% 85535.27 40197 192359 85553.94 71303 98056 2585539 2585539 0.00
crit 17.07 36.09% 171558.87 80394 384718 171652.72 132467 231656 2928689 2928689 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 142.7 63.84% 86257.60 38 192359 86289.61 77349 95667 12310547 12310547 0.00
crit 80.8 36.16% 172372.48 150 384718 172403.43 148700 199531 13934412 13934412 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up|buff.shadowmeld.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][] While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 84758 27.5% 22.9 15.51sec 1665561 1658146 Periodic 326.6 85864 171749 116820 36.0% 96.1%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.91 0.00 326.60 326.60 1.0045 1.3247 38153942.40 38153942.40 0.00 83736.48 1658146.13
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 208.9 63.96% 85863.71 67 99005 85856.42 79609 90106 17936656 17936656 0.00
crit 117.7 36.04% 171749.36 133 198011 171727.17 160466 181056 20217287 20217287 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 29696 9.6% 108.5 4.15sec 122984 122433 Direct 108.5 90389 180847 122986 36.0%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.53 108.53 0.00 0.00 1.0045 0.0000 13347036.59 19621408.05 31.98 122433.03 122433.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.42 63.97% 90389.33 63161 136190 90404.37 85267 96558 6274649 9224328 31.98
crit 39.11 36.03% 180846.69 126321 272380 180768.31 162024 198364 7072388 10397080 31.98
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing $sw1 Physical damage to the target. Deals {$106785s2=20}% increased damage against bleeding targets. While stealthed, Shred deals $5215m4% increased damage, and has double the chance to critically strike. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Simple Action Stats Execute Interval
unstable_arcanocrystal_860
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unstable_arcanocrystal_860
  • harmful:false
  • if_expr:
 
Berserk 3.0 181.91sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unstable_arcanocrystal_860
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unstable_arcanocrystal_860
  • harmful:false
  • if_expr:
 
Healing Touch 50.6 9.01sec

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 50.58 0.00 0.00 0.00 0.8723 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:19800.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.bloodtalons.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:
  • description:Heals a friendly target for {$s1=0 to 2}$?s54825[ and reduces your remaining cooldown on Nature's Swiftness by $54825m1 sec][].{$?s24858=false}|s197625[ Usable while in Moonkin Form.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 18.6 24.67sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.61 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Shadowmeld 3.6 133.34sec

Stats details: shadowmeld

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowmeld

Static Values
  • id:58984
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Spelldata
  • id:58984
  • name:Shadowmeld
  • school:physical
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
 
Tiger's Fury 15.2 30.32sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.23 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 15.2 0.0 30.3sec 30.3sec 10.12% 10.19% 45.5(45.5) 15.1

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:15.00

Stack Uptimes

  • ashamanes_energy_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 3.0 0.0 181.9sec 181.9sec 9.80% 14.96% 0.0(0.0) 2.9

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.11% 0.0(0.0) 1.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bloodtalons 50.6 0.0 9.0sec 9.0sec 46.29% 46.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_bloodtalons
  • max_stacks:2
  • duration:30.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • bloodtalons_1:18.97%
  • bloodtalons_2:27.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:145152
  • name:Bloodtalons
  • tooltip:Your next two melee abilities deal {$s1=50}% increased damage for their full duration.
  • description:Casting Healing Touch causes your next two melee abilities to deal {$s1=50}% increased damage for their full duration.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
Cat Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 43.4 1.3 10.2sec 9.9sec 6.31% 15.20% 1.3(1.3) 0.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:6.31%

Trigger Attempt Success

  • trigger_pct:8.75%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Jacin's Ruse 6.6 1.8 64.1sec 48.7sec 24.52% 24.60% 1.8(1.8) 6.4

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_jacins_ruse
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:3000.00

Stack Uptimes

  • jacins_ruse_1:24.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224149
  • name:Jacin's Ruse
  • tooltip:Mastery increased by {$s1=3000}.
  • description:{$@spelldesc224148=Your spells and attacks have a chance to increase your Mastery by {$224149s1=3000} for {$224149d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (nightborne_delicacy_platter) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 353.2sec 0.0sec 10.81% 10.92% 0.0(0.0) 2.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will echo your melee attacks and abilities.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 50.3 1.2 8.9sec 8.7sec 74.26% 74.27% 1.2(1.2) 0.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:74.26%

Trigger Attempt Success

  • trigger_pct:98.49%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Healing Touch, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Healing Touch, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Savage Roar 8.1 10.5 48.4sec 24.6sec 93.53% 93.25% 202.6(202.6) 7.1

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:93.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Shadowmeld 3.6 0.0 133.5sec 133.5sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_shadowmeld
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:58984
  • name:Shadowmeld
  • tooltip:Shadowmelded.
  • description:Activate to slip into the shadows, reducing the chance for enemies to detect your presence. Lasts until cancelled or upon moving. Any threat is restored versus enemies still in combat upon cancellation of this effect.
  • max_stacks:0
  • duration:-0.00
  • cooldown:120.00
  • default_chance:100.00%
Tiger's Fury 15.2 0.0 30.3sec 30.3sec 26.83% 29.14% 0.0(0.0) 15.0

Buff details

  • buff initial source:unstable_arcanocrystal_860
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=60} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
unstable_arcanocrystal_860
ferocious_bite Energy 21.5 363.0 16.9 33.8 8304.0
ferocious_bite Combo Points 10.7 49.7 4.6 4.6 60605.9
lunar_inspiration Energy 31.6 783.0 24.8 24.8 13176.6
rake Energy 47.3 1346.0 28.5 28.5 23595.2
rip Energy 22.9 466.7 20.4 20.4 81756.3
rip Combo Points 22.9 114.5 5.0 5.0 333122.2
savage_roar Energy 18.6 479.4 25.8 25.8 0.0
savage_roar Combo Points 18.6 93.0 5.0 5.0 0.0
shred Energy 108.5 3221.0 29.7 29.7 4143.8
Resource Gains Type Count Total Average Overflow
rake Combo Points 47.30 47.30 (18.15%) 1.00 0.00 0.00%
tigers_fury Energy 15.23 913.06 (11.28%) 59.96 0.54 0.06%
ashamanes_frenzy Combo Points 6.11 18.32 (7.03%) 3.00 0.00 0.00%
lunar_inspiration Combo Points 31.60 31.60 (12.13%) 1.00 0.00 0.00%
shred Combo Points 108.53 108.53 (41.65%) 1.00 0.00 0.00%
energy_regen Energy 1983.01 5041.15 (62.27%) 2.54 71.65 1.40%
clearcasting Energy 43.29 1478.96 (18.27%) 34.16 0.00 0.00%
ashamanes_energy Energy 45.47 662.93 (8.19%) 14.58 19.14 2.81%
primal_fury Combo Points 67.58 54.79 (21.03%) 0.81 12.79 18.93%
Resource RPS-Gain RPS-Loss
Energy 14.71 14.80
Combo Points 0.58 0.57
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 34.32 0.04 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.21 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
clearcasting 44.7 9.9sec
clearcasting_wasted 1.3 123.7sec
primal_fury 67.6 6.6sec

Statistics & Data Analysis

Fight Length
Sample Data unstable_arcanocrystal_860 Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data unstable_arcanocrystal_860 Damage Per Second
Count 2499
Mean 308646.78
Minimum 277453.84
Maximum 344141.99
Spread ( max - min ) 66688.15
Range [ ( max - min ) / 2 * 100% ] 10.80%
Standard Deviation 10097.1082
5th Percentile 292409.13
95th Percentile 325284.94
( 95th Percentile - 5th Percentile ) 32875.80
Mean Distribution
Standard Deviation 201.9826
95.00% Confidence Intervall ( 308250.90 - 309042.66 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4111
0.1 Scale Factor Error with Delta=300 870317
0.05 Scale Factor Error with Delta=300 3481269
0.01 Scale Factor Error with Delta=300 87031744
Priority Target DPS
Sample Data unstable_arcanocrystal_860 Priority Target Damage Per Second
Count 2499
Mean 308646.78
Minimum 277453.84
Maximum 344141.99
Spread ( max - min ) 66688.15
Range [ ( max - min ) / 2 * 100% ] 10.80%
Standard Deviation 10097.1082
5th Percentile 292409.13
95th Percentile 325284.94
( 95th Percentile - 5th Percentile ) 32875.80
Mean Distribution
Standard Deviation 201.9826
95.00% Confidence Intervall ( 308250.90 - 309042.66 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4111
0.1 Scale Factor Error with Delta=300 870317
0.05 Scale Factor Error with Delta=300 3481269
0.01 Scale Factor Error with Delta=300 87031744
DPS(e)
Sample Data unstable_arcanocrystal_860 Damage Per Second (Effective)
Count 2499
Mean 308646.78
Minimum 277453.84
Maximum 344141.99
Spread ( max - min ) 66688.15
Range [ ( max - min ) / 2 * 100% ] 10.80%
Damage
Sample Data unstable_arcanocrystal_860 Damage
Count 2499
Mean 138793111.46
Minimum 103818068.81
Maximum 174637436.13
Spread ( max - min ) 70819367.31
Range [ ( max - min ) / 2 * 100% ] 25.51%
DTPS
Sample Data unstable_arcanocrystal_860 Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data unstable_arcanocrystal_860 Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data unstable_arcanocrystal_860 Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data unstable_arcanocrystal_860 Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data unstable_arcanocrystal_860 Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data unstable_arcanocrystal_860 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data unstable_arcanocrystal_860Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data unstable_arcanocrystal_860 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 healing_touch,if=talent.bloodtalons.enabled
4 0.00 cat_form
5 0.00 prowl
6 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
7 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
0.00 wild_charge
0.00 displacer_beast,if=movement.distance>10
0.00 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
8 4.56 rake,if=buff.prowl.up|buff.shadowmeld.up
9 4.56 auto_attack
0.00 skull_bash
A 2.96 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 15.23 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
D 3.99 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
E 49.58 healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
0.00 healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
Special logic for Ailuro Pouncers legendary.
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
I 8.11 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 22.91 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
K 10.50 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
0.00 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 6.75 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
M 6.11 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
0.00 swipe_cat,if=spell_targets.swipe_cat>=6
N 3.56 shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
Shadowmeld to buff Rake
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
O 42.74 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
P 31.60 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
Q 108.53 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

012345789PQCAQIQEMJQQOPQELOQQQEJQQPQEKOQCQQEJN89QPEKQOQEJOPQCQEJOPQEKOQQEJMPQELOQCQEJOPQEIQOQQEJOPQQECJOPQQEIOQPEOJQQQCPQEIMN89QEJQQQPEJOQQEICAOPQQEJOQQELQPQQEJOQQEIOPQCQEJOQQEKOPQQQEJMOPELOQCQQEJQQPQEIOOQEOJPCQQQEJN89QPEIQOPEOJCQQQQEIMOEJOPQQEJOPQEKCQOQQEJQQPEKOQQQEDOPCABQQELOQQQEKOPQQELQQQOELMPQEKCOQQQQELOPQQEKOPDCQQQOEKOPQEDQQ

Sample Sequence Table

time name target resources buffs
Pre flask unstable_arcanocrystal_860 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre food unstable_arcanocrystal_860 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre augmentation unstable_arcanocrystal_860 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points
Pre healing_touch Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2)
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, potion_of_the_old_war
0:01.003 lunar_inspiration Fluffy_Pillow 76.4/100: 76% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:02.007 shred Fluffy_Pillow 60.9/100: 61% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, bloodtalons, potion_of_the_old_war
0:03.012 tigers_fury Fluffy_Pillow 35.4/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, potion_of_the_old_war
0:03.012 berserk Fluffy_Pillow 95.4/100: 95% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:03.012 shred Fluffy_Pillow 95.4/150: 64% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:04.017 savage_roar Fluffy_Pillow 104.8/150: 70% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, clearcasting, ashamanes_energy, berserk, tigers_fury, potion_of_the_old_war
0:05.021 shred Fluffy_Pillow 134.3/150: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:06.025 healing_touch Fluffy_Pillow 143.7/150: 96% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:06.780 ashamanes_frenzy Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:07.785 rip Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons, berserk, savage_roar, tigers_fury, potion_of_the_old_war
0:08.791 shred Fluffy_Pillow 149.5/150: 100% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, clearcasting, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:09.795 shred Fluffy_Pillow 150.0/150: 100% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:10.798 rake Fluffy_Pillow 144.4/150: 96% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
0:11.803 lunar_inspiration Fluffy_Pillow 141.4/150: 94% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:12.807 shred Fluffy_Pillow 140.9/150: 94% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:13.812 healing_touch Fluffy_Pillow 135.3/150: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:14.565 ferocious_bite Fluffy_Pillow 146.2/150: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
0:15.570 rake Fluffy_Pillow 135.6/150: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:16.573 shred Fluffy_Pillow 132.6/150: 88% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:17.578 shred Fluffy_Pillow 127.0/150: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
0:18.583 shred Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:19.587 healing_touch Fluffy_Pillow 74.5/100: 74% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:20.340 Waiting 0.100 sec 85.3/100: 85% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, potion_of_the_old_war
0:20.440 rip Fluffy_Pillow 86.7/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, potion_of_the_old_war
0:21.444 shred Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
0:22.448 shred Fluffy_Pillow 45.6/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, potion_of_the_old_war
0:23.454 Waiting 1.439 sec 20.1/100: 20% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:24.893 lunar_inspiration Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:25.899 shred Fluffy_Pillow 25.3/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar
0:26.903 healing_touch Fluffy_Pillow 39.8/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar
0:27.658 savage_roar Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar
0:29.429 rake Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons(2), predatory_swiftness, savage_roar
0:30.435 Waiting 1.752 sec 15.6/100: 16% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:32.187 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar
0:33.191 tigers_fury Fluffy_Pillow 15.3/100: 15% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar
0:33.191 shred Fluffy_Pillow 75.3/100: 75% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:34.193 shred Fluffy_Pillow 64.7/100: 65% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.199 healing_touch Fluffy_Pillow 54.2/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
0:35.953 Waiting 0.400 sec 65.0/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
0:36.353 rip Fluffy_Pillow 85.8/100: 86% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, bloodtalons(2), savage_roar, tigers_fury
0:37.357 shadowmeld Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:37.357 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodlust, shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
0:37.357 auto_attack Fluffy_Pillow 35.3/100: 35% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:38.362 shred Fluffy_Pillow 49.7/100: 50% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.367 Waiting 0.500 sec 24.2/100: 24% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:39.867 lunar_inspiration Fluffy_Pillow 31.4/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:40.872 healing_touch Fluffy_Pillow 15.9/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury
0:41.813 Waiting 5.700 sec 26.3/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:47.513 savage_roar Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
0:48.518 shred Fluffy_Pillow 60.5/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
0:49.523 Waiting 0.100 sec 31.6/100: 32% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
0:49.879 rake Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
0:50.884 shred Fluffy_Pillow 46.7/100: 47% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
0:51.889 healing_touch Fluffy_Pillow 17.8/100: 18% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
0:52.796 rip Fluffy_Pillow 27.9/100: 28% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
0:53.800 rake Fluffy_Pillow 39.0/100: 39% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
0:54.803 Waiting 1.392 sec 15.1/100: 15% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:56.195 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
0:57.198 Waiting 2.606 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
0:59.804 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:00.809 Waiting 2.208 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:03.017 tigers_fury Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:03.191 shred Fluffy_Pillow 98.0/100: 98% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:04.197 healing_touch Fluffy_Pillow 84.1/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:05.104 rip Fluffy_Pillow 94.2/100: 94% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:06.109 rake Fluffy_Pillow 90.3/100: 90% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:07.112 lunar_inspiration Fluffy_Pillow 81.4/100: 81% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
1:08.117 shred Fluffy_Pillow 62.5/100: 63% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:09.121 healing_touch Fluffy_Pillow 33.7/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
1:10.029 Waiting 4.100 sec 43.7/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
1:14.129 savage_roar Fluffy_Pillow 89.1/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:15.133 rake Fluffy_Pillow 60.2/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
1:16.138 Waiting 0.400 sec 36.4/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:16.538 shred Fluffy_Pillow 40.8/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
1:17.544 Waiting 1.180 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:18.724 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
1:19.728 healing_touch Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:20.636 Waiting 0.700 sec 46.2/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:21.336 rip Fluffy_Pillow 53.9/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
1:22.341 ashamanes_frenzy Fluffy_Pillow 65.1/100: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
1:23.345 lunar_inspiration Fluffy_Pillow 76.2/100: 76% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
1:24.351 shred Fluffy_Pillow 87.3/100: 87% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:25.355 healing_touch Fluffy_Pillow 58.4/100: 58% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:26.262 Waiting 1.900 sec 68.5/100: 68% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:28.162 ferocious_bite Fluffy_Pillow 89.5/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:29.165 rake Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:30.172 Waiting 1.200 sec 26.8/100: 27% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:31.372 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:32.376 Waiting 1.248 sec 11.2/100: 11% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:33.624 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:33.624 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:34.628 healing_touch Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
1:35.535 Waiting 0.100 sec 81.2/100: 81% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:35.635 rip Fluffy_Pillow 97.3/100: 97% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
1:36.639 rake Fluffy_Pillow 93.4/100: 93% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
1:37.643 lunar_inspiration Fluffy_Pillow 69.5/100: 69% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
1:38.648 shred Fluffy_Pillow 80.6/100: 81% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
1:39.651 healing_touch Fluffy_Pillow 51.7/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury
1:40.558 savage_roar Fluffy_Pillow 61.8/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), tigers_fury
1:41.562 shred Fluffy_Pillow 72.9/100: 73% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury
1:42.565 rake Fluffy_Pillow 84.0/100: 84% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
1:43.568 shred Fluffy_Pillow 60.1/100: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
1:44.571 Waiting 0.800 sec 31.2/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:45.371 shred Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
1:46.377 healing_touch Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
1:47.284 Waiting 6.138 sec 21.3/100: 21% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:53.422 rip Fluffy_Pillow 89.2/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
1:54.427 rake Fluffy_Pillow 70.3/100: 70% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
1:55.430 lunar_inspiration Fluffy_Pillow 46.5/100: 46% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
1:56.434 Waiting 1.200 sec 27.6/100: 28% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:57.634 shred Fluffy_Pillow 40.9/100: 41% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
1:58.638 Waiting 2.576 sec 12.0/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:01.214 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:02.220 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:03.129 Waiting 0.297 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:03.426 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:03.624 Waiting 0.200 sec 87.2/100: 87% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:03.824 rip Fluffy_Pillow 89.4/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
2:04.826 rake Fluffy_Pillow 85.5/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, tigers_fury
2:05.831 lunar_inspiration Fluffy_Pillow 76.6/100: 77% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
2:06.836 shred Fluffy_Pillow 72.8/100: 73% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
2:07.839 shred Fluffy_Pillow 43.9/100: 44% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, tigers_fury
2:08.844 healing_touch Fluffy_Pillow 15.0/100: 15% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
2:11.284 savage_roar Fluffy_Pillow 42.0/100: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury
2:14.333 rake Fluffy_Pillow 35.8/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
2:15.337 Waiting 2.584 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:17.921 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
2:18.926 Waiting 1.707 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:20.633 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:21.636 Waiting 1.206 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:22.842 healing_touch Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:23.751 rake Fluffy_Pillow 35.1/100: 35% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
2:24.755 rip Fluffy_Pillow 11.2/100: 11% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons, savage_roar
2:25.761 Waiting 1.642 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:27.403 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
2:28.409 Waiting 2.606 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:31.015 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:32.020 Waiting 1.208 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:33.228 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
2:34.230 tigers_fury Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
2:34.230 lunar_inspiration Fluffy_Pillow 96.1/100: 96% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:35.236 shred Fluffy_Pillow 92.2/100: 92% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:36.241 healing_touch Fluffy_Pillow 78.4/100: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, jacins_ruse
2:37.147 savage_roar Fluffy_Pillow 88.4/100: 88% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, tigers_fury, jacins_ruse
2:38.151 ashamanes_frenzy Fluffy_Pillow 74.5/100: 75% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:39.155 shadowmeld Fluffy_Pillow 85.6/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:39.155 rake Fluffy_Pillow 85.6/100: 86% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:39.155 auto_attack Fluffy_Pillow 50.6/100: 51% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:40.158 shred Fluffy_Pillow 61.7/100: 62% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:41.162 healing_touch Fluffy_Pillow 32.9/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
2:42.071 rip Fluffy_Pillow 42.9/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
2:43.075 shred Fluffy_Pillow 54.0/100: 54% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
2:44.079 Waiting 0.500 sec 25.2/100: 25% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:44.579 shred Fluffy_Pillow 30.7/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar
2:45.584 shred Fluffy_Pillow 41.8/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
2:46.588 Waiting 1.589 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:48.177 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
2:49.183 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
2:50.090 Waiting 0.796 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:50.886 rip Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
2:52.909 rake Fluffy_Pillow 22.9/100: 23% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
2:53.914 Waiting 0.600 sec 34.1/100: 34% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:54.514 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
2:55.519 Waiting 2.589 sec 11.8/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:58.108 shred Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
2:59.112 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:00.017 Waiting 1.203 sec 21.6/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:01.729 savage_roar Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
3:04.012 tigers_fury Fluffy_Pillow 25.9/100: 26% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:04.230 berserk Fluffy_Pillow 88.3/100: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
3:04.230 rake Fluffy_Pillow 88.3/150: 59% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:05.234 lunar_inspiration Fluffy_Pillow 96.9/150: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:06.237 shred Fluffy_Pillow 108.0/150: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
3:07.241 shred Fluffy_Pillow 134.1/150: 89% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:08.245 healing_touch Fluffy_Pillow 125.2/150: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:09.152 rip Fluffy_Pillow 135.3/150: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, tigers_fury
3:10.155 rake Fluffy_Pillow 131.4/150: 88% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury
3:11.161 shred Fluffy_Pillow 125.0/150: 83% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:12.166 shred Fluffy_Pillow 116.2/150: 77% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury
3:13.169 healing_touch Fluffy_Pillow 107.3/150: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar
3:14.075 ferocious_bite Fluffy_Pillow 117.3/150: 78% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar
3:15.078 shred Fluffy_Pillow 103.4/150: 69% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar
3:16.083 lunar_inspiration Fluffy_Pillow 94.5/150: 63% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar
3:17.088 shred Fluffy_Pillow 90.7/150: 60% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar
3:18.093 shred Fluffy_Pillow 81.8/150: 55% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar
3:19.098 healing_touch Fluffy_Pillow 72.9/150: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, berserk, predatory_swiftness, savage_roar
3:20.006 rip Fluffy_Pillow 83.0/100: 83% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
3:21.010 rake Fluffy_Pillow 94.1/100: 94% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:22.013 shred Fluffy_Pillow 70.2/100: 70% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
3:23.017 shred Fluffy_Pillow 41.3/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:24.021 healing_touch Fluffy_Pillow 12.4/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:24.929 Waiting 0.826 sec 22.5/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:26.523 savage_roar Fluffy_Pillow 40.1/100: 40% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2)
3:29.829 rake Fluffy_Pillow 36.8/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
3:30.834 Waiting 1.594 sec 12.9/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
3:32.428 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:33.432 shred Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:34.436 tigers_fury Fluffy_Pillow 22.8/100: 23% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
3:34.436 shred Fluffy_Pillow 82.8/100: 83% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:35.440 healing_touch Fluffy_Pillow 68.9/100: 69% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:36.348 Waiting 0.100 sec 78.9/100: 79% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
3:36.448 rip Fluffy_Pillow 95.0/100: 95% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury, jacins_ruse
3:37.454 rake Fluffy_Pillow 91.2/100: 91% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:38.458 shred Fluffy_Pillow 67.3/100: 67% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:39.463 Waiting 0.200 sec 38.4/100: 38% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:39.663 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:40.669 healing_touch Fluffy_Pillow 51.8/100: 52% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
3:41.575 Waiting 2.500 sec 61.8/100: 62% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
3:44.075 savage_roar Fluffy_Pillow 89.5/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
3:45.080 rake Fluffy_Pillow 60.6/100: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
3:46.084 lunar_inspiration Fluffy_Pillow 36.7/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:47.090 Waiting 0.742 sec 17.9/100: 18% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
3:47.832 shred Fluffy_Pillow 26.1/100: 26% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
3:48.836 shred Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
3:49.840 shred Fluffy_Pillow 48.3/100: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
3:50.843 healing_touch Fluffy_Pillow 19.4/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
3:51.751 Waiting 4.900 sec 29.5/100: 30% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:56.651 rip Fluffy_Pillow 83.8/100: 84% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
3:57.656 ashamanes_frenzy Fluffy_Pillow 64.9/100: 65% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
3:58.660 rake Fluffy_Pillow 76.0/100: 76% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
3:59.662 lunar_inspiration Fluffy_Pillow 52.1/100: 52% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:00.665 healing_touch Fluffy_Pillow 33.2/100: 33% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar
4:01.572 ferocious_bite Fluffy_Pillow 43.3/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
4:02.576 rake Fluffy_Pillow 29.4/100: 29% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
4:03.581 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:04.588 tigers_fury Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:04.588 shred Fluffy_Pillow 71.6/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:05.593 shred Fluffy_Pillow 57.8/100: 58% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:06.597 healing_touch Fluffy_Pillow 43.9/100: 44% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:07.505 rip Fluffy_Pillow 53.9/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), ashamanes_energy, savage_roar, tigers_fury
4:08.509 shred Fluffy_Pillow 80.1/100: 80% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:09.513 shred Fluffy_Pillow 51.2/100: 51% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
4:10.518 Waiting 0.742 sec 22.3/100: 22% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:11.260 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
4:12.264 Waiting 2.605 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
4:14.869 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness
4:15.874 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:16.780 savage_roar Fluffy_Pillow 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2)
4:18.040 rake Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
4:19.045 Waiting 2.097 sec 11.7/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:21.398 rake Fluffy_Pillow 37.8/100: 38% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar
4:22.402 Waiting 2.401 sec 13.9/100: 14% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:24.803 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
4:25.808 Waiting 1.508 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:27.316 healing_touch Fluffy_Pillow 28.3/100: 28% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
4:28.223 rake Fluffy_Pillow 38.4/100: 38% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons(2), savage_roar
4:29.225 Waiting 1.451 sec 14.5/100: 14% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
4:30.676 rip Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
4:31.680 Waiting 1.706 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
4:33.386 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
4:34.391 tigers_fury Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
4:34.588 shred Fluffy_Pillow 73.8/100: 74% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:35.592 shred Fluffy_Pillow 60.0/100: 60% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:36.596 shred Fluffy_Pillow 46.1/100: 46% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
4:37.601 healing_touch Fluffy_Pillow 72.2/100: 72% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
4:38.509 Waiting 0.700 sec 82.3/100: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:39.209 rip Fluffy_Pillow 90.0/100: 90% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
4:40.213 shadowmeld Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:40.213 rake Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points shadowmeld, bloodtalons, predatory_swiftness, savage_roar, tigers_fury
4:40.213 auto_attack Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury
4:41.217 shred Fluffy_Pillow 47.3/100: 47% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury
4:42.222 Waiting 1.097 sec 18.4/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
4:43.319 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness
4:44.323 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness
4:47.016 savage_roar Fluffy_Pillow 41.5/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), jacins_ruse
4:48.019 Waiting 2.522 sec 12.6/100: 13% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
4:50.541 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
4:53.849 rake Fluffy_Pillow 37.1/100: 37% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
4:54.854 Waiting 2.360 sec 13.3/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:57.214 lunar_inspiration Fluffy_Pillow 39.4/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:58.218 healing_touch Fluffy_Pillow 20.5/100: 21% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, jacins_ruse
4:59.634 rake Fluffy_Pillow 36.2/100: 36% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:00.640 Waiting 1.644 sec 12.3/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar, jacins_ruse
5:02.284 rip Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons, savage_roar
5:03.287 Waiting 1.206 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
5:04.493 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:04.588 shred Fluffy_Pillow 86.0/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:05.591 shred Fluffy_Pillow 72.1/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:06.594 shred Fluffy_Pillow 58.3/100: 58% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:07.599 shred Fluffy_Pillow 44.4/100: 44% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:08.605 healing_touch Fluffy_Pillow 15.5/100: 16% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, jacins_ruse
5:09.513 Waiting 1.600 sec 25.6/100: 26% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury, jacins_ruse
5:11.113 savage_roar Fluffy_Pillow 43.3/100: 43% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), tigers_fury, jacins_ruse
5:12.631 ashamanes_frenzy Fluffy_Pillow 20.1/100: 20% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar, jacins_ruse
5:14.171 rake Fluffy_Pillow 37.2/100: 37% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
5:15.174 healing_touch Fluffy_Pillow 13.3/100: 13% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse
5:16.081 Waiting 2.352 sec 23.3/100: 23% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
5:18.433 rip Fluffy_Pillow 49.4/100: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
5:19.438 rake Fluffy_Pillow 60.5/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:20.442 lunar_inspiration Fluffy_Pillow 36.6/100: 37% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:21.448 Waiting 0.655 sec 17.7/100: 18% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:22.103 shred Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar
5:23.109 Waiting 0.400 sec 36.1/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:23.509 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:24.514 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:25.423 Waiting 3.193 sec 21.8/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:28.616 rip Fluffy_Pillow 57.1/100: 57% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:29.621 rake Fluffy_Pillow 68.2/100: 68% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
5:30.626 lunar_inspiration Fluffy_Pillow 44.4/100: 44% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
5:31.631 Waiting 0.100 sec 25.5/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:31.731 shred Fluffy_Pillow 26.6/100: 27% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar
5:32.737 healing_touch Fluffy_Pillow 37.7/100: 38% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:33.645 savage_roar Fluffy_Pillow 47.8/100: 48% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:34.647 tigers_fury Fluffy_Pillow 18.9/100: 19% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:34.647 shred Fluffy_Pillow 78.9/100: 79% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:35.652 rake Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:36.657 shred Fluffy_Pillow 56.2/100: 56% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
5:37.662 shred Fluffy_Pillow 82.3/100: 82% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
5:38.665 healing_touch Fluffy_Pillow 53.4/100: 53% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
5:39.571 Waiting 0.700 sec 63.4/100: 63% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
5:40.271 rip Fluffy_Pillow 71.2/100: 71% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, tigers_fury
5:41.275 shred Fluffy_Pillow 82.3/100: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, tigers_fury
5:42.278 shred Fluffy_Pillow 53.4/100: 53% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, tigers_fury
5:43.283 Waiting 1.000 sec 24.5/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:44.283 lunar_inspiration Fluffy_Pillow 35.6/100: 36% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:45.287 healing_touch Fluffy_Pillow 16.7/100: 17% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:46.194 Waiting 2.500 sec 26.8/100: 27% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:48.694 savage_roar Fluffy_Pillow 54.4/100: 54% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar
5:49.698 rake Fluffy_Pillow 65.6/100: 66% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
5:50.704 shred Fluffy_Pillow 41.7/100: 42% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
5:51.710 shred Fluffy_Pillow 52.8/100: 53% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
5:52.714 Waiting 1.500 sec 24.0/100: 24% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:54.214 shred Fluffy_Pillow 40.6/100: 41% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar
5:55.219 healing_touch Fluffy_Pillow 11.7/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
5:56.126 Waiting 2.094 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
5:58.220 ferocious_bite Fluffy_Pillow 44.9/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:00.753 rake Fluffy_Pillow 28.0/100: 28% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
6:01.757 lunar_inspiration Fluffy_Pillow 39.2/100: 39% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:02.760 Waiting 1.726 sec 20.3/100: 20% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:04.486 tigers_fury Fluffy_Pillow 39.4/100: 39% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:04.647 berserk Fluffy_Pillow 100.0/100: 100% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:04.647 potion Fluffy_Pillow 100.0/150: 67% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury
6:04.647 shred Fluffy_Pillow 100.0/150: 67% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:05.652 shred Fluffy_Pillow 106.1/150: 71% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:06.657 healing_touch Fluffy_Pillow 112.3/150: 75% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:07.563 ferocious_bite Fluffy_Pillow 122.3/150: 82% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), ashamanes_energy, berserk, savage_roar, tigers_fury, potion_of_the_old_war
6:08.567 rake Fluffy_Pillow 123.4/150: 82% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:09.571 shred Fluffy_Pillow 117.0/150: 78% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:10.575 shred Fluffy_Pillow 108.1/150: 72% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:11.581 shred Fluffy_Pillow 99.3/150: 66% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:12.584 healing_touch Fluffy_Pillow 90.4/150: 60% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, tigers_fury, potion_of_the_old_war
6:13.492 savage_roar Fluffy_Pillow 100.4/150: 67% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:14.495 rake Fluffy_Pillow 91.5/150: 61% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:15.500 lunar_inspiration Fluffy_Pillow 85.2/150: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:16.503 shred Fluffy_Pillow 81.3/150: 54% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:17.506 shred Fluffy_Pillow 72.4/150: 48% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:18.510 healing_touch Fluffy_Pillow 63.5/150: 42% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points berserk, predatory_swiftness, savage_roar, potion_of_the_old_war
6:19.418 ferocious_bite Fluffy_Pillow 73.6/150: 49% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), berserk, savage_roar, potion_of_the_old_war
6:20.420 shred Fluffy_Pillow 59.7/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, potion_of_the_old_war
6:21.423 Waiting 0.900 sec 30.8/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:22.323 shred Fluffy_Pillow 40.7/100: 41% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:23.328 Waiting 2.586 sec 11.9/100: 12% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:25.914 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:26.918 Waiting 1.209 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:28.127 rake Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:29.131 healing_touch Fluffy_Pillow 36.1/100: 36% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, jacins_ruse, potion_of_the_old_war
6:30.039 Waiting 1.700 sec 46.2/100: 46% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, jacins_ruse
6:31.739 ferocious_bite Fluffy_Pillow 65.0/100: 65% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points clearcasting, bloodtalons(2), savage_roar, jacins_ruse
6:32.744 ashamanes_frenzy Fluffy_Pillow 51.1/100: 51% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar, jacins_ruse
6:33.749 lunar_inspiration Fluffy_Pillow 62.3/100: 62% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, jacins_ruse
6:34.754 shred Fluffy_Pillow 73.4/100: 73% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, jacins_ruse
6:35.761 healing_touch Fluffy_Pillow 44.5/100: 45% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:36.668 savage_roar Fluffy_Pillow 54.6/100: 55% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:37.672 tigers_fury Fluffy_Pillow 25.7/100: 26% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
6:37.672 rake Fluffy_Pillow 85.7/100: 86% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:38.675 shred Fluffy_Pillow 76.8/100: 77% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points bloodtalons, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:39.679 shred Fluffy_Pillow 62.9/100: 63% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
6:40.684 shred Fluffy_Pillow 89.0/100: 89% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
6:41.688 shred Fluffy_Pillow 60.2/100: 60% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, tigers_fury
6:42.693 healing_touch Fluffy_Pillow 31.3/100: 31% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
6:43.599 Waiting 4.300 sec 41.3/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
6:47.899 ferocious_bite Fluffy_Pillow 88.9/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:48.903 rake Fluffy_Pillow 50.1/100: 50% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons, predatory_swiftness, savage_roar
6:49.908 lunar_inspiration Fluffy_Pillow 61.2/100: 61% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
6:50.914 shred Fluffy_Pillow 42.3/100: 42% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points predatory_swiftness, savage_roar
6:51.918 Waiting 2.443 sec 13.4/100: 13% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:54.361 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar
6:55.365 healing_touch Fluffy_Pillow 11.6/100: 12% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
6:56.272 Waiting 1.702 sec 21.7/100: 22% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
6:57.974 savage_roar Fluffy_Pillow 40.5/100: 41% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:01.279 rake Fluffy_Pillow 37.1/100: 37% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons(2), predatory_swiftness, savage_roar
7:02.284 Waiting 1.563 sec 13.2/100: 13% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
7:03.847 lunar_inspiration Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
7:06.134 ferocious_bite Fluffy_Pillow 25.9/100: 26% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points bloodtalons, predatory_swiftness, savage_roar
7:07.138 Waiting 1.253 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:08.391 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points predatory_swiftness, savage_roar
7:08.391 shred Fluffy_Pillow 85.0/100: 85% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:09.394 shred Fluffy_Pillow 71.1/100: 71% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:10.398 shred Fluffy_Pillow 57.2/100: 57% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury
7:11.401 rake Fluffy_Pillow 43.3/100: 43% energy | 0.0/100: 0% rage | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury
7:12.406 healing_touch Fluffy_Pillow 19.5/100: 19% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury
7:13.313 Waiting 5.400 sec 29.5/100: 29% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar, tigers_fury
7:18.713 savage_roar Fluffy_Pillow 89.3/100: 89% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:19.718 rake Fluffy_Pillow 60.4/100: 60% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points clearcasting, bloodtalons(2), predatory_swiftness, savage_roar
7:20.722 lunar_inspiration Fluffy_Pillow 71.5/100: 72% energy | 0.0/100: 0% rage | 2.0/5: 40% combo_points bloodtalons, predatory_swiftness, savage_roar
7:21.726 shred Fluffy_Pillow 52.7/100: 53% energy | 0.0/100: 0% rage | 4.0/5: 80% combo_points bloodtalons, predatory_swiftness, savage_roar
7:22.730 healing_touch Fluffy_Pillow 23.8/100: 24% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points predatory_swiftness, savage_roar
7:23.637 ferocious_bite Fluffy_Pillow 33.8/100: 34% energy | 0.0/100: 0% rage | 5.0/5: 100% combo_points bloodtalons(2), savage_roar
7:24.642 Waiting 2.652 sec 11.1/100: 11% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:27.294 shred Fluffy_Pillow 40.5/100: 40% energy | 0.0/100: 0% rage | 0.0/5: 0% combo_points bloodtalons, predatory_swiftness, savage_roar
7:28.297 Waiting 1.710 sec 11.6/100: 12% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points predatory_swiftness, savage_roar
7:30.007 shred Fluffy_Pillow 30.5/100: 31% energy | 0.0/100: 0% rage | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4723 4398 0
Agility 21649 19943 9960 (8420)
Stamina 28365 28365 17628
Intellect 7653 7328 0
Spirit 0 0 0
Health 1701900 1701900 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 25979 23932 0
Crit 36.08% 36.08% 7027
Haste 10.73% 10.73% 3488
Damage / Heal Versatility 7.65% 7.65% 3058
Attack Power 21649 19943 0
Mastery 56.30% 54.16% 6678
Armor 1957 1957 1957
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 845.00
Local Head Hood of the Blind Executioner
ilevel: 840, stats: { 259 Armor, +1772 Sta, +1182 AgiInt, +844 Crit, +413 Mastery }
Local Neck Brysngamen, Torc of Helheim
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Vers }, enchant: mark_of_the_distant_army
Local Shoulders Mantle of the Dark Sea
ilevel: 840, stats: { 239 Armor, +1329 Sta, +886 AgiInt, +633 Crit, +310 Mastery }
Local Chest Biornskin Vest
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +817 Crit, +440 Mastery }
Local Waist Sinister Ashfall Cord
ilevel: 840, stats: { 179 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Mastery }
Local Legs Warden's Martial Greaves
ilevel: 840, stats: { 279 Armor, +1772 Sta, +1182 AgiInt, +736 Vers, +521 Mastery }
Local Feet Tunnel Trudger Footguards
ilevel: 840, stats: { 219 Armor, +886 AgiInt, +1329 Sta, +674 Crit, +269 Haste }
Local Wrists Shorn Batbrood Cuffs
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +505 Crit, +202 Mastery }
Local Hands Guileful Intruder Handguards
ilevel: 840, stats: { 199 Armor, +886 AgiInt, +1329 Sta, +653 Crit, +289 Haste }
Local Finger1 Loop of Eightfold Eyes
ilevel: 840, stats: { +997 Sta, +1213 Mastery, +555 Vers }, enchant: { +200 Mastery }
Local Finger2 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +200 Mastery }
Local Trinket1 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Mainsail Cloak
ilevel: 840, stats: { 126 Armor, +665 StrAgiInt, +997 Sta, +455 Vers, +252 Mastery }, enchant: { +200 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }, relics: { +40 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 870, weapon: { 2749 - 5106, 1.8 }, stats: { +670 Agi, +1005 Sta, +306 Crit, +294 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="unstable_arcanocrystal_860"
level=110
race=night_elf
timeofday=day
role=attack
position=back
talents=3323322
artifact=58:137340:137465:137307:0:1153:1:1154:1:1157:1:1158:1:1161:6:1163:3:1164:3:1165:3:1166:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/healing_touch,if=talent.bloodtalons.enabled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up|buff.shadowmeld.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
# Use Healing Touch at 5 Combo Points, if Predatory Swiftness is about to fall off, at 2 Combo Points before Ashamane's Frenzy, before Elune's Guidance is cast or before the Elune's Guidance buff gives you a 5th Combo Point.
actions+=/healing_touch,if=talent.bloodtalons.enabled&buff.predatory_swiftness.up&(combo_points>=5|buff.predatory_swiftness.remains<1.5|(talent.bloodtalons.enabled&combo_points=2&buff.bloodtalons.down&cooldown.ashamanes_frenzy.remains<gcd)|(talent.elunes_guidance.enabled&((cooldown.elunes_guidance.remains<gcd&combo_points=0)|(buff.elunes_guidance.up&combo_points>=4))))
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
# Special logic for Ailuro Pouncers legendary.
actions+=/healing_touch,if=equipped.ailuro_pouncers&talent.bloodtalons.enabled&buff.predatory_swiftness.stack>1&buff.bloodtalons.down
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Shadowmeld to buff Rake
actions.generator+=/shadowmeld,if=combo_points<5&energy>=action.rake.cost&dot.rake.pmultiplier<2.1&buff.tigers_fury.up&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(!talent.incarnation.enabled|cooldown.incarnation.remains>18)&!buff.incarnation.up
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Hard-cast a Healing Touch for Bloodtalons buff. Use Dash to re-enter Cat Form.
actions.sbt_opener=healing_touch,if=talent.bloodtalons.enabled&combo_points=5&!buff.bloodtalons.up&!dot.rip.ticking
# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener+=/tigers_fury,if=!dot.rip.ticking&combo_points=5

head=hood_of_the_blind_executioner,id=137511,bonus_id=1727
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727,enchant=mark_of_the_distant_army
shoulders=mantle_of_the_dark_sea,id=137332,bonus_id=1727
back=mainsail_cloak,id=134406,bonus_id=1727,enchant=binding_of_agility
chest=biornskin_vest,id=134197,bonus_id=1727
wrists=shorn_batbrood_cuffs,id=136979,bonus_id=1727
hands=guileful_intruder_handguards,id=137480,bonus_id=1727
waist=sinister_ashfall_cord,id=134455,bonus_id=1727
legs=wardens_martial_greaves,id=137515,bonus_id=1727
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727
finger1=loop_of_eightfold_eyes,id=134527,bonus_id=1727,enchant=binding_of_mastery
finger2=jeweled_signet_of_melandrus,id=134542,bonus_id=1727,enchant=binding_of_mastery
trinket1=unstable_arcanocrystal,id=141482,ilevel=860
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/137350/137327,relic_id=1727/1727/1727
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=845.33
# gear_agility=9960
# gear_stamina=17628
# gear_crit_rating=7027
# gear_haste_rating=2325
# gear_mastery_rating=6678
# gear_versatility_rating=3058
# gear_armor=1957
# set_bonus=tier19p_leather_2pc=1

Simulation & Raid Information

Iterations: 2502
Threads: 3
Confidence: 95.00%
Fight Length (fixed time): 360 - 540 ( 450.0 )

Performance:
Total Events Processed: 125624469
Max Event Queue: 293
Sim Seconds: 1125849
CPU Seconds: 174.0659
Physical Seconds: 105.8568
Speed Up: 6468

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
baseline baseline ashamanes_frenzy 210722 1159745 2577 12.15 9514 19032 6.1 91.1 33.8% 0.0% 0.0% 0.0% 78.84sec 6781432 449.98sec
baseline baseline ashamanes_frenzy ticks -210722 5076497 11281 16.16 125895 251565 6.1 121.2 33.9% 0.0% 0.0% 0.0% 78.84sec 6781432 449.98sec
baseline baseline ashamanes_rip ticks -210705 14886087 33080 18.70 79322 158770 17.9 140.2 33.8% 0.0% 0.0% 0.0% 23.76sec 14886087 449.98sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
baseline baseline berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.00sec 0 449.98sec
baseline baseline cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
baseline baseline cat_melee 0 12012105 26695 65.77 18194 36393 493.3 493.3 33.8% 0.0% 0.0% 0.0% 0.91sec 17658932 449.98sec
baseline baseline ferocious_bite 22568 2538638 5642 1.32 183298 403119 9.9 9.9 33.5% 0.0% 0.0% 0.0% 48.21sec 3732038 449.98sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
baseline baseline healing_touch 5185 0 0 0.00 0 0 48.9 0.0 0.0% 0.0% 0.0% 0.0% 9.32sec 0 449.98sec
baseline baseline lunar_inspiration 155625 1391884 3093 4.21 32983 65948 31.6 31.6 33.7% 0.0% 0.0% 0.0% 14.37sec 9632891 449.98sec
baseline baseline lunar_inspiration ticks -155625 8241007 18313 32.28 25449 50918 31.6 242.1 33.7% 0.0% 0.0% 0.0% 14.37sec 9632891 449.98sec
baseline baseline mark_of_the_distant_army ticks -191380 954614 2121 9.26 13749 0 23.5 69.4 0.0% 0.0% 0.0% 0.0% 18.78sec 1403374 449.98sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
baseline baseline potion_of_the_old_war 188028 4799578 10666 3.06 156406 313147 22.9 22.9 33.8% 0.0% 0.0% 0.0% 17.71sec 7055835 449.98sec
baseline baseline rake 1822 5103005 11341 6.25 81166 163120 46.9 46.9 33.8% 0.0% 0.0% 0.0% 9.65sec 29482759 449.98sec
baseline baseline rake ticks -1822 24379754 54177 29.79 81590 162906 46.9 223.4 33.9% 0.0% 0.0% 0.0% 9.65sec 29482759 449.98sec
baseline baseline rip ticks -1079 35386375 78636 43.30 81478 162957 22.6 324.8 33.7% 0.0% 0.0% 0.0% 15.91sec 35386375 449.98sec
baseline baseline savage_roar 52610 0 0 0.00 0 0 18.4 0.0 0.0% 0.0% 0.0% 0.0% 25.03sec 0 449.98sec
baseline baseline shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.62sec 0 449.98sec
baseline baseline shred 5221 12493603 27765 14.09 88410 176796 105.6 105.6 33.8% 0.0% 0.0% 0.0% 4.25sec 18366779 449.98sec
baseline baseline tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.33sec 0 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 ashamanes_frenzy 210722 1241385 2759 12.18 10169 20337 6.1 91.3 33.6% 0.0% 0.0% 0.0% 78.45sec 7260864 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 ashamanes_frenzy ticks -210722 5435911 12080 16.21 134520 269043 6.1 121.6 33.8% 0.0% 0.0% 0.0% 78.45sec 7260864 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 ashamanes_rip ticks -210705 16647959 36995 19.48 85169 170417 18.6 146.1 33.8% 0.0% 0.0% 0.0% 22.88sec 16647959 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 181.99sec 0 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 cat_melee 0 13238675 29421 69.04 19104 38195 517.8 517.8 33.9% 0.0% 0.0% 0.0% 0.87sec 19462106 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 ferocious_bite 22568 3077420 6839 1.43 204390 452195 10.7 10.7 33.5% 0.0% 0.0% 0.0% 44.06sec 4524099 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 healing_touch 5185 0 0 0.00 0 0 50.4 0.0 0.0% 0.0% 0.0% 0.0% 9.03sec 0 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 lunar_inspiration 155625 1491589 3315 4.22 35284 70578 31.6 31.6 33.6% 0.0% 0.0% 0.0% 14.32sec 10778309 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 lunar_inspiration ticks -155625 9286720 20637 34.09 27163 54348 31.6 255.6 33.7% 0.0% 0.0% 0.0% 14.32sec 10778309 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 mark_of_the_distant_army ticks -191380 1004256 2232 9.73 13764 0 24.7 73.0 0.0% 0.0% 0.0% 0.0% 17.99sec 1476352 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 potion_of_the_old_war 188028 5045025 11212 3.21 156627 313111 24.1 24.1 33.8% 0.0% 0.0% 0.0% 16.95sec 7416664 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 rake 1822 5520354 12268 6.30 87160 174567 47.3 47.3 33.9% 0.0% 0.0% 0.0% 9.54sec 31813439 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 rake ticks -1822 26293085 58429 29.83 87740 175747 47.3 223.7 33.8% 0.0% 0.0% 0.0% 9.54sec 31813439 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 rip ticks -1079 38190307 84867 43.50 87545 175060 22.9 326.3 33.7% 0.0% 0.0% 0.0% 15.45sec 38190307 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 savage_roar 52610 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 24.66sec 0 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 132.64sec 0 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 shred 5221 13742821 30541 14.77 92673 185323 110.8 110.8 33.9% 0.0% 0.0% 0.0% 4.06sec 20203248 449.98sec
bloodthirsty_instinct_865 bloodthirsty_instinct_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.34sec 0 449.98sec
natures_call_865 natures_call_865 ashamanes_frenzy 210722 1203646 2675 12.17 9725 19468 6.1 91.3 35.5% 0.0% 0.0% 0.0% 78.45sec 7035970 449.98sec
natures_call_865 natures_call_865 ashamanes_frenzy ticks -210722 5266496 11703 16.20 128661 257508 6.1 121.5 35.6% 0.0% 0.0% 0.0% 78.45sec 7035970 449.98sec
natures_call_865 natures_call_865 ashamanes_rip ticks -210705 15854833 35233 19.20 81305 162537 18.3 144.0 35.5% 0.0% 0.0% 0.0% 22.96sec 15854833 449.98sec
natures_call_865 natures_call_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
natures_call_865 natures_call_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 181.89sec 0 449.98sec
natures_call_865 natures_call_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
natures_call_865 natures_call_865 cat_melee 0 12475245 27724 67.42 18231 36468 505.6 505.6 35.3% 0.0% 0.0% 0.0% 0.89sec 18339792 449.98sec
natures_call_865 natures_call_865 cleansed_drakes_breath 222520 0 0 0.00 0 0 4.3 0.0 0.0% 0.0% 0.0% 0.0% 77.87sec 0 449.98sec
natures_call_865 natures_call_865 ferocious_bite 22568 2834796 6300 1.40 188812 417964 10.5 10.5 35.5% 0.0% 0.0% 0.0% 45.05sec 4167419 449.98sec
natures_call_865 natures_call_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
natures_call_865 natures_call_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
natures_call_865 natures_call_865 healing_touch 5185 0 0 0.00 0 0 50.1 0.0 0.0% 0.0% 0.0% 0.0% 9.11sec 0 449.98sec
natures_call_865 natures_call_865 lunar_inspiration 155625 1412958 3140 4.21 32994 66027 31.6 31.6 35.6% 0.0% 0.0% 0.0% 14.35sec 9992768 449.98sec
natures_call_865 natures_call_865 lunar_inspiration ticks -155625 8579810 19066 33.28 25381 50769 31.6 249.6 35.4% 0.0% 0.0% 0.0% 14.35sec 9992768 449.98sec
natures_call_865 natures_call_865 mark_of_the_distant_army ticks -191380 980187 2178 9.49 13778 0 24.1 71.1 0.0% 0.0% 0.0% 0.0% 18.39sec 1440968 449.98sec
natures_call_865 natures_call_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
natures_call_865 natures_call_865 potion_of_the_old_war 188028 5003616 11120 3.15 156481 313235 23.6 23.6 35.5% 0.0% 0.0% 0.0% 17.19sec 7355789 449.98sec
natures_call_865 natures_call_865 rake 1822 5311852 11805 6.29 83285 166627 47.2 47.2 35.2% 0.0% 0.0% 0.0% 9.58sec 30690924 449.98sec
natures_call_865 natures_call_865 rake ticks -1822 25379072 56398 29.80 83742 167890 47.2 223.5 35.4% 0.0% 0.0% 0.0% 9.58sec 30690924 449.98sec
natures_call_865 natures_call_865 rip ticks -1079 36852395 81894 43.47 83531 167005 22.8 326.0 35.3% 0.0% 0.0% 0.0% 15.68sec 36852395 449.98sec
natures_call_865 natures_call_865 savage_roar 52610 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 24.76sec 0 449.98sec
natures_call_865 natures_call_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.58sec 0 449.98sec
natures_call_865 natures_call_865 shred 5221 12918548 28709 14.36 88629 177226 107.7 107.7 35.4% 0.0% 0.0% 0.0% 4.17sec 18991489 449.98sec
natures_call_865 natures_call_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.32sec 0 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 ashamanes_frenzy 210722 1161387 2581 12.17 9518 19035 6.1 91.3 33.7% 0.0% 0.0% 0.0% 78.51sec 6790075 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 ashamanes_frenzy ticks -210722 5082726 11295 16.19 125990 251495 6.1 121.4 33.9% 0.0% 0.0% 0.0% 78.51sec 6790075 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 ashamanes_rip ticks -210705 15491090 34425 19.38 79641 159215 18.6 145.3 33.9% 0.0% 0.0% 0.0% 22.83sec 15491090 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 181.95sec 0 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 cat_melee 0 12549335 27889 68.57 18231 36462 514.2 514.2 33.9% 0.0% 0.0% 0.0% 0.87sec 18448710 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 ferocious_bite 22568 2815616 6257 1.41 189056 418849 10.6 10.6 33.6% 0.0% 0.0% 0.0% 44.98sec 4139223 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 healing_touch 5185 0 0 0.00 0 0 50.2 0.0 0.0% 0.0% 0.0% 0.0% 9.09sec 0 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 infested_ground 221803 2374010 5276 10.36 22835 45694 7.9 77.7 33.8% 0.0% 0.0% 0.0% 60.65sec 2374010 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 lunar_inspiration 155625 1394572 3099 4.22 32993 66021 31.6 31.6 33.7% 0.0% 0.0% 0.0% 14.35sec 10029903 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 lunar_inspiration ticks -155625 8635331 19190 33.81 25451 50886 31.6 253.6 33.8% 0.0% 0.0% 0.0% 14.35sec 10029903 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 mark_of_the_distant_army ticks -191380 987476 2194 9.56 13772 0 24.2 71.7 0.0% 0.0% 0.0% 0.0% 18.32sec 1451684 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 potion_of_the_old_war 188028 4982106 11072 3.17 156773 313574 23.8 23.8 33.6% 0.0% 0.0% 0.0% 17.15sec 7324168 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 rake 1822 5151167 11448 6.30 81643 162744 47.2 47.2 33.8% 0.0% 0.0% 0.0% 9.55sec 29707699 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 rake ticks -1822 24556532 54570 29.82 82004 164264 47.2 223.7 33.8% 0.0% 0.0% 0.0% 9.55sec 29707699 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 rip ticks -1079 35736696 79415 43.53 81804 163625 22.8 326.5 33.8% 0.0% 0.0% 0.0% 15.49sec 35736696 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 savage_roar 52610 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 24.70sec 0 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.47sec 0 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 shred 5221 13028880 28954 14.69 88462 176885 110.2 110.2 33.7% 0.0% 0.0% 0.0% 4.08sec 19153688 449.98sec
ravaged_seed_pod_865 ravaged_seed_pod_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.33sec 0 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 ashamanes_frenzy 210722 1205305 2679 12.16 9867 19749 6.1 91.2 33.9% 0.0% 0.0% 0.0% 78.78sec 7037641 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 ashamanes_frenzy ticks -210722 5265728 11702 16.18 130620 260836 6.1 121.4 33.9% 0.0% 0.0% 0.0% 78.78sec 7037641 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 ashamanes_rip ticks -210705 15438408 34308 18.73 82221 164507 18.0 140.5 33.7% 0.0% 0.0% 0.0% 23.45sec 15438408 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 182.06sec 0 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 cat_melee 0 12005729 26681 65.77 18193 36384 493.3 493.3 33.8% 0.0% 0.0% 0.0% 0.91sec 17649558 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 ferocious_bite 22568 2541556 5648 1.32 183150 403075 9.9 9.9 33.8% 0.0% 0.0% 0.0% 48.30sec 3736328 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 healing_touch 5185 0 0 0.00 0 0 48.9 0.0 0.0% 0.0% 0.0% 0.0% 9.32sec 0 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 horrific_slam 222168 3023219 6719 12.78 23563 47089 95.8 95.8 33.9% 0.0% 0.0% 0.0% 3.69sec 3023219 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 lunar_inspiration 155625 1392614 3095 4.21 32954 65929 31.5 31.5 34.0% 0.0% 0.0% 0.0% 14.36sec 9623121 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 lunar_inspiration ticks -155625 8230506 18290 32.26 25445 50880 31.5 242.0 33.7% 0.0% 0.0% 0.0% 14.36sec 9623121 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 mark_of_the_distant_army ticks -191380 955377 2123 9.27 13747 0 23.5 69.5 0.0% 0.0% 0.0% 0.0% 18.74sec 1404494 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 potion_of_the_old_war 188028 4825588 10724 3.07 156502 312790 23.0 23.0 34.1% 0.0% 0.0% 0.0% 17.54sec 7094072 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 rake 1822 5283857 11742 6.25 84208 168530 46.9 46.9 33.7% 0.0% 0.0% 0.0% 9.64sec 30554270 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 rake ticks -1822 25270413 56156 29.80 84516 169047 46.9 223.5 33.8% 0.0% 0.0% 0.0% 9.64sec 30554270 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 rip ticks -1079 36709823 81577 43.33 84450 168976 22.6 325.0 33.7% 0.0% 0.0% 0.0% 15.78sec 36709823 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 savage_roar 52610 0 0 0.00 0 0 18.3 0.0 0.0% 0.0% 0.0% 0.0% 25.07sec 0 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.63sec 0 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 shred 5221 12487068 27750 14.08 88401 176846 105.6 105.6 33.8% 0.0% 0.0% 0.0% 4.26sec 18357173 449.98sec
spontaneous_appendages_865 spontaneous_appendages_865 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.35sec 0 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 ashamanes_frenzy 210722 1239229 2754 12.18 9979 19956 6.1 91.4 35.9% 0.0% 0.0% 0.0% 78.52sec 7244457 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 ashamanes_frenzy ticks -210722 5422673 12050 16.21 131968 264072 6.1 121.5 36.1% 0.0% 0.0% 0.0% 78.52sec 7244457 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 ashamanes_rip ticks -210705 16458779 36575 19.32 83529 166968 18.4 144.9 36.0% 0.0% 0.0% 0.0% 23.26sec 16458779 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 berserk 106951 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 181.91sec 0 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 cat_melee 0 12907637 28685 68.05 18589 37181 510.3 510.3 36.1% 0.0% 0.0% 0.0% 0.88sec 18975449 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 ferocious_bite 22568 3014621 6699 1.43 194691 431487 10.7 10.7 36.4% 0.0% 0.0% 0.0% 43.81sec 4431778 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 healing_touch 5185 0 0 0.00 0 0 50.6 0.0 0.0% 0.0% 0.0% 0.0% 9.01sec 0 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 lunar_inspiration 155625 1446645 3215 4.21 33652 67266 31.6 31.6 36.1% 0.0% 0.0% 0.0% 14.35sec 10316894 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 lunar_inspiration ticks -155625 8870248 19712 33.60 25883 51777 31.6 252.0 36.0% 0.0% 0.0% 0.0% 14.35sec 10316894 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 mark_of_the_distant_army ticks -191380 1010526 2246 9.59 14043 0 24.3 72.0 0.0% 0.0% 0.0% 0.0% 18.27sec 1485569 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 potion_of_the_old_war 188028 5162587 11473 3.17 159741 319589 23.8 23.8 36.0% 0.0% 0.0% 0.0% 16.86sec 7589492 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 rake 1822 5514228 12254 6.31 85535 171559 47.3 47.3 36.1% 0.0% 0.0% 0.0% 9.53sec 31759186 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 rake ticks -1822 26244958 58322 29.81 86258 172372 47.3 223.6 36.2% 0.0% 0.0% 0.0% 9.53sec 31759186 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 rip ticks -1079 38153942 84787 43.55 85864 171749 22.9 326.6 36.0% 0.0% 0.0% 0.0% 15.51sec 38153942 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 savage_roar 52610 0 0 0.00 0 0 18.6 0.0 0.0% 0.0% 0.0% 0.0% 24.67sec 0 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 shadowmeld 58984 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 133.34sec 0 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 shred 5221 13347037 29661 14.47 90389 180847 108.5 108.5 36.0% 0.0% 0.0% 0.0% 4.15sec 19621408 449.98sec
unstable_arcanocrystal_860 unstable_arcanocrystal_860 tigers_fury 5217 0 0 0.00 0 0 15.2 0.0 0.0% 0.0% 0.0% 0.0% 30.32sec 0 449.98sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.07% 9.07% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.07%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.39% 9.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.39%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.82% 9.82% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.82%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.77% 10.77% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.77%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.74% 10.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.74%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.36% 10.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.36%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.81% 10.81% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.01% 11.01% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.01%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.49% 10.49% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.49%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 7.56% 7.56% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:7.56%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 1793283.94
Combat End Resource Mean Min Max
Health 13412760.18 0.00 49511713.06

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 2499
Mean 449.98
Minimum 360.04
Maximum 539.93
Spread ( max - min ) 179.89
Range [ ( max - min ) / 2 * 100% ] 19.99%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 2499
Mean 1801441.56
Minimum 1717580.19
Maximum 1894183.66
Spread ( max - min ) 176603.47
Range [ ( max - min ) / 2 * 100% ] 4.90%
Standard Deviation 26843.1120
5th Percentile 1759393.77
95th Percentile 1847817.79
( 95th Percentile - 5th Percentile ) 88424.02
Mean Distribution
Standard Deviation 536.9696
95.00% Confidence Intervall ( 1800389.12 - 1802494.00 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 852
0.1 Scale Factor Error with Delta=300 6151051
0.05 Scale Factor Error with Delta=300 24604207
0.01 Scale Factor Error with Delta=300 615105196
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 622
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 657961535 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.